KEGG   Leuconostoc carnosum: C270_06830Help
Entry
C270_06830        CDS       T02321                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
lcn  Leuconostoc carnosum
Pathway
lcn00900  Terpenoid backbone biosynthesis
lcn01110  Biosynthesis of secondary metabolites
lcn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lcn00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    C270_06830
Enzymes [BR:lcn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     C270_06830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red ZT_dimer
Motif
Other DBs
NCBI-ProteinID: AFT82275
UniProt: K0DBQ4
Position
complement(1429384..1430598)
Genome map
AA seq 404 aa AA seqDB search
MTKKYYELTPDERLASLNLKQETMTAFQENRTPQHAQIIENYISDFRVPMGMLHDIIVNG
QHVSVPMAIEEPSVIAAANNGAKMINSVGGVKAMLPKRTAMIGQMMFVDMPITVLDDFVL
SHQNELLAIAQRAKPTIYQRGGGLLSVTTRQVSPTEVSVDFIIDTQDAMGANIVNTILEA
EISAFSKFETHLIGVILSNHALEQIVTVKVNMTFDSVGGHDVAQKIVALNHFAKNDPYRA
TTENKGLFNGIGAVVLATGNDWRAVEASGHAYASRDGQYRALASWTIQEDQLIGELSMPI
SVGTVGGAISAMPQAKNVLNIMKITSADELRTIILATGLAQNLAALKAIASGGIQRGHMR
MQYRVLALQVGATMSEVPILVAKLNQLKQVDTTIASKLLSEIRK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaatattatgaactgacgccggatgaacgtttggcgtctttaaatttaaag
caagaaacaatgactgcatttcaagaaaatcgaacaccacagcatgcgcaaattattgaa
aactatatcagcgattttcgtgtgccgatggggatgttgcatgatattatagttaacggg
caacatgtcagtgtaccaatggccatcgaagaaccaagcgtgatagcagcagctaataat
ggtgctaaaatgatcaattcagttggcggtgttaaggcaatgttacctaaaagaacggca
atgatcgggcaaatgatgtttgttgatatgccgattacggtgctagatgattttgtgttg
tcacatcaaaatgaattactagcaattgcccagcgagcaaaaccaacaatttatcagcgt
ggtggtggtttattatcagttacaacacggcaagtatcacctacagaagtgagtgttgat
tttataattgatacgcaagatgcgatgggtgctaatattgtcaatacaattttagaagca
gaaataagcgctttttctaaatttgaaacacatctaataggtgtgattttaagtaatcac
gctttggaacaaattgttactgtaaaggttaatatgacatttgatagtgtgggtggacat
gatgtcgcacaaaagatagtagcattaaatcactttgcaaaaaatgatccttatcgtgca
acaacagaaaataaaggcctattcaatggtattggtgcagttgtattggcgacgggcaat
gattggcgtgctgttgaagctagtggtcacgcctatgctagccgtgacggacaatatcgt
gcattagcttcatggacaattcaagaggaccagctgattggggagttgtctatgccgatt
tctgttggtactgtgggcggggctatttcagccatgccacaggctaaaaatgtgttaaat
atcatgaagattacttctgctgatgaactacgtacaatcattttagcgacaggattagca
caaaacttagctgctctaaaggctattgcgtcaggtggtattcaacgtggacacatgcgt
atgcaatatcgtgtactggctttgcaagttggggcaactatgtcagaagtacccattctg
gttgctaaattaaatcagttaaagcaagttgatactactattgcatcaaaattattatcg
gagataagaaaatga

DBGET integrated database retrieval system