KEGG   Larimichthys crocea (large yellow croaker): 104917703Help
Entry
104917703         CDS       T04659                                 

Gene name
rock1
Definition
(RefSeq) rho-associated protein kinase 1 isoform X1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04270  Vascular smooth muscle contraction
lco04350  TGF-beta signaling pathway
lco04510  Focal adhesion
lco04530  Tight junction
lco04810  Regulation of actin cytoskeleton
lco05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    104917703 (rock1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104917703 (rock1)
   04530 Tight junction
    104917703 (rock1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104917703 (rock1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104917703 (rock1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104917703 (rock1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lco01001]
    104917703 (rock1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lco03036]
    104917703 (rock1)
Enzymes [BR:lco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104917703 (rock1)
Protein kinases [BR:lco01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   104917703 (rock1)
Chromosome and associated proteins [BR:lco03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104917703 (rock1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH HR1 C1_1 Pkinase_C Cortex-I_coil APH Filament
Motif
Other DBs
NCBI-GeneID: 104917703
NCBI-ProteinID: XP_010727522
Position
II
AA seq 1381 aa AA seqDB search
MSAGESMEARFEKIDAMLKDPKSEVNTDCLLDGLDALVYDLDFPALRKNKSIDNFLNRYK
DTISKIRDLRMKAVDYEVVKVIGRGAFGEVQLVRHKATRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSSWVVQLFFAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDGIHAMGFIHRDVKPDNMLLDKAGHLKLADFGTCMKMNKDGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNALTFP
DDSDITNDAKNLICAFLTDREVRLGRNGVDEIKRHPFFKNDQWTWENIRETAAPVVPELS
SDIDTSNFDDIEEDRGEEETFPIPKAFVGNQLPFVGFTYYSNHNLLRRSTSSTKTSDKRS
SSTKEDKSHLENLQKRIYQLEEQLHSEMQLKDELEQKCRTSNTKIDKIMKELDEEANLRK
SAEASVSLLEKDKIMLQHRFTEYQRKADQEAEKRRNLENEVSTLKEQLEDMRKISQNSQA
SNDKIVQLQNQLEEANDLLRAESDTAARLRKSHTEMGKSMSQLESLNRELQERSRAVDGE
KAQLEKELLLLQSTLDSERRNYSQGSEEIRELQARMSGLQEDNKSLKLSVSKVETERKQA
QERSNNLEKEKNNLEIDLNYKLKTLQQRLEQEQTEHRVTRAQLTDKYESIEEAKSAAMNA
VQQKMSEENGARMRAESRVVEVEKQCSMLEFDLKQSVQKMEQLMKQKERLEDEVKSLRIQ
GEQESSKRVLVQSDLKSRLQEVDRLRCSEKQLKQEINTALESKRSLEFQLAQLTKQYRGN
EGQMRELQDQLEAEQYFSTLYKTQVKELKEEIEDRNRQIQEAQKKVQELCSERDSLSAQL
DLTVTKAESEQLARALQEEQYFELSQENKKAGTRHKQEIVEKEATIARLEESNKTLTKDV
ENLSKEKSELNEKLRGQEEEYLAQKEEITNTIKANYEKVLNTERTLKTQAVNKLAEIMNR
KDMKLDQKKKGSTADLRKKEKENRKLQLELNQEKDKFNHMAIKYQKELSEMQAQLAEECT
YRNELQMQLDSKESDIEQLREKLNDLQQRMDNSSVTSLQTDETDGNIAESRLEGWLSIPN
RANIKRYGWKKQYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAET
EEIPRIFQILYANEGECRKEADMETVPQGDKTNCLPHKGHEFIPTLYHFPSNCEACSKPL
WHVFKPPPALECRRCHVKCHKDHLDKKEDVIAPCKVNYDVTSARDMLLLALTQDEQKKWI
GHLGKKIPKTPPSTFSRASPRSMSTRSGPNQSFRKNPKSNTGKLSRAQSSLQAADTTSST
C
NT seq 4146 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccggggaaagtatggaggctcggtttgaaaaaatcgatgccatgttgaaagac
ccaaagtcagaagtaaacacggattgtcttctggatggcttggacgcactggtgtatgac
cttgactttcctgccctgaggaaaaacaagagcattgacaactttttgaatagatacaag
gacaccattagtaaaattcgggatctacgcatgaaagcagtggactatgaggtggttaaa
gttattgggaggggagcatttggagaggttcaattggtaagacacaaagccacgcgtaaa
gtatacgccatgaagctgctgagcaagtttgagatgatcaagaggtcggactctgctttc
ttttgggaggagagggacatcatggcttttgccaacagctcatgggtggtgcagctcttt
tttgcattccaagatgaccgctacctctacatggtgatggaatacatgcccggtggcgac
ttggtcaacttgatgagcaactacgacgtcccagagaagtgggcccgcttttacacggct
gaggtggtgctggctctggatggaatccacgccatgggcttcattcacagggacgtgaag
cctgataacatgttgctagacaaagcaggccacttaaaactggcagactttgggacctgc
atgaaaatgaacaaggacggtatggtacgatgtgacacagcagtgggaactccagattac
atttcgcctgaggtactgaaatctcaaggaggagatggctattatggcagagagtgtgac
tggtggtcagtgggagtgttcctgtacgaaatgctagttggcgacactcctttctacgca
gactccctggtggggacgtacagcaaaattatgaaccacaagaatgccctgaccttcccc
gacgacagcgatatcaccaatgacgccaagaatctcatctgtgctttcctgacagacagg
gaggttcgacttggccgcaacggcgtcgatgagatcaagaggcaccccttctttaagaat
gaccagtggacatgggagaacatcagagagacggctgccccagtagtacctgaactaagc
agtgacattgacaccagtaactttgacgacatcgaggaggaccggggggaggaggagacc
ttccccataccaaaggcctttgtgggcaaccagctccccttcgtaggcttcacttattac
agcaatcacaaccttttgcgcaggtccacctcctccacaaagaccagtgacaaacgtagc
agctccacaaaagaagacaagagtcatctggagaacctgcagaaaaggatctaccagctg
gaggagcagctccacagtgagatgcagctgaaggatgagttggaacagaaatgcaggaca
tcaaacaccaagattgacaagatcatgaaagaactggatgaagaggcaaacctgaggaag
agcgccgaggccagcgtgtctctgctggagaaggacaagatcatgctgcagcacagattc
acagagtaccaaagaaaagctgaccaggaggcagagaagagacgaaatttggagaatgag
gtgtcgactttaaaggagcagcttgaagatatgaggaagatcagccagaactctcaggcc
tcaaatgacaagatagtccagctgcagaatcagctggaagaggccaatgacctcctgcgg
gcagagtcggacacggcagcgagactgcggaagagccacacagagatgggcaagtcaatg
agccagttggagagcttgaaccgcgagctgcaggagaggagccgcgcagtggacggggag
aaggcccagctggagaaggagctcctgctccttcaaagcaccttggactcggagaggagg
aactacagccagggctctgaggagatcagagagctgcaagcgaggatgtcagggttgcaa
gaggacaacaaaagcttgaagctcagcgtctctaaagtggagacagaacgcaaacaggcc
caggagaggagcaataacctggaaaaggaaaagaacaacctggagatagacctgaactac
aaactgaagaccttgcagcagcgtctggagcaagaacagactgagcacagggtgacgcgg
gcacagctcactgacaaatatgagtctattgaagaagccaaatcagctgccatgaatgct
gttcagcagaagatgtctgaggagaacggggcacggatgcgagcggagagccgggtagtg
gaggttgagaagcagtgctcaatgttagaatttgacctcaagcagtctgtgcagaagatg
gagcagctgatgaaacaaaaagaacggctagaggatgaggtgaagagtctacggatacag
ggagagcaggagtcgagcaaacgcgtcctggttcagagcgacctgaagagccgcttgcag
gaggtggaccgccttaggtgttcagagaagcagctcaaacaggagatcaacacagcacta
gagagtaaacgctcgctggagttccagctggcacagttgaccaaacaatacagaggcaac
gagggacagatgagggaacttcaggaccagcttgaggccgaacagtatttttctacgctt
tacaaaactcaggtcaaggaattaaaagaggagatcgaggataggaaccggcagatacag
gaggctcagaaaaaggtgcaggagttgtgcagtgaaagggattccctgtctgctcagctg
gatctgacggtgaccaaggccgaatccgagcagcttgcccgggcacttcaagaggaacag
tactttgagctcagccaggagaacaagaaggcagggacaagacataagcaggagatcgtg
gagaaggaggccactattgcacgacttgaggaatcaaataaaactctgaccaaagatgtg
gagaacctcagcaaagagaagtctgagttaaatgagaagcttcgtggtcaggaggaagag
tatttagctcagaaggaagagattacaaacacaatcaaggccaactatgagaaggtcctc
aacactgagcgcacactgaagactcaggcggtgaacaagctggcagagatcatgaaccgc
aaagacatgaagctggaccagaagaagaagggcagtactgccgacctacggaagaaggag
aaggaaaaccgcaaacttcagctggagctgaaccaggagaaggacaagttcaaccacatg
gccatcaagtaccagaaggagttgagcgagatgcaggcgcaactggcagaggagtgcacg
tatcgcaacgagctgcaaatgcagctggacagcaaggagagtgacatcgagcagcttcgg
gagaaactgaacgacctgcagcagcgcatggataactccagtgtcaccagcttgcagaca
gatgagacagacggcaacatcgcagaatccagattggagggttggctgtccattcctaac
cgtgctaatatcaagcgatacggatggaagaagcagtatgtggtggtgagcagtaagaag
attctgttctacaatgatgagcaggataaggaacagtccaacccctcaatggtactagat
atcgacaaattgttccatgtgagaccagtcactcaaggagacgtgtaccgagctgagacg
gaggagattccaaggatattccagattctgtatgccaacgagggagagtgcaggaaggag
gccgacatggagacggtccctcagggtgacaagaccaactgtctcccacacaaaggccac
gagttcatccccacactatatcacttcccttccaactgtgaggcctgctccaagcctctg
tggcacgtcttcaagccacctccggccctggagtgtcgccgctgccacgtcaagtgccac
aaggaccacctcgacaaaaaggaggatgttattgctccttgcaaagtaaactacgatgtg
acctctgcccgggacatgctcctgctggccctgacccaagatgagcagaagaaatggatt
ggccaccttggaaagaagatcccgaagaccccaccatccacattttcacgggcctcacct
cgttctatgtccactcgctccggaccaaaccagtccttccgcaagaaccctaaaagcaat
acaggaaagctgagcagagcgcagtccagcctccaagcagcagatacaacatccagcact
tgttga

DBGET integrated database retrieval system