KEGG   Larimichthys crocea (large yellow croaker): 104918237Help
Entry
104918237         CDS       T04659                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4 isoform X1
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104918237
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lco01001]
    104918237
Enzymes [BR:lco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104918237
Protein kinases [BR:lco01001]
 Serine/threonine kinases: STE group
  STE20 family
   104918237
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 104918237
NCBI-ProteinID: XP_027133672
Position
I
AA seq 1438 aa AA seqDB search
MDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITD
LVKNTKGNTLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVS
AQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCD
MHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYTQRPPTEQLLKHPFIRDQPNE
RQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEEASEQEGEPSSIVNVPGESTLRRD
FIRLQQENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRR
EREMRRQQEREQRRREQEEKRRIEEMERRRKEEEERRRAEEEKRRADREQEYIRRQLEEE
QRHLEILQQQLLHEQAMLLEYKWRELEEQRQAQKLQRQLQQEQAYLLSLQQNQNLDSNKT
AQQQSIKPPQNPEQDRINPPQSPEPDTAKQPQSTDLDKTQNRSLEKTTEPKQPVADLQGP
APDSEPVREADERYRKNIQGSPQAAQTKPQQPPVPPRSESSYPNGNSASEAPAMHRPVEP
QVRSHLAALKSSGSVASSNSSATAPPIVSRSLSEPLAPSFENLHLRNSQEPHQHHHPPSS
SSSSSSSSSSSSSTPARTDPQPHPQLRPSPHEVTPSEEVPPRVPVRTTSRSPVLPRRDSP
HHHGNASHSSHAVQRNTASAAEPRLLWERVEKLVPRPTSNTGSGGSSSSSSSSNSSSQPG
SHCGSGERFRARSSSKSEGSPLQRPENAGKKPEERRDLVRPSRPADLTALAKELRAVDDV
RPPNKVTDYSSSSEESDTTDEDDDEEVDQEAGEESTSGPEDSRAVSSRLSNGETESVKTM
IVHDEGESDAGSTPCKDSTLIVRQSAGDNRKRPSPGPGQAQTPVRLAGFAPSPGSGSGPA
LGQHTPSPHHHHHHHHHHPTQHSDRNGFAGRIHHLPDLIQQSHHSSPSSTASNSPSSSSL
ASPSSMSPQSPLDKLGILTESQSSNNMQKHKSSSSFTPFIDPRLLQVSPSTGSALNNVGY
ANDARLAEALRADPSRKGSVVNVNPVNTRPQSDTPEIRKYKKRFNSEILCAALWGVNLLV
GTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNKI
LHNDPEVEKKQGWTTVGDLEGCVHYKVVKYERIKFLVLALKNSVEVYAWAPKPYHKFMAF
KSFGDLVHKPLLVDLTVEEGQRLKVIYGSCSGFHAVDVDSGAVYDIYLPTHIQTSIQSHA
IIILPNTDGIELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQIMGWGEKAI
EIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRSNLLSW
NT seq 4317 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcacagaggatgaagaggaggaaattaagctggagatcaacatgctgaagaag
tactcccatcacagaaacatagccacctactatggagccttcatcaagaaaagtcccccg
ggccatgacgaccagctatggctggtgatggagttctgcggcgccggttccatcacagac
cttgtgaagaacaccaaaggcaacacactgaaggaggactggatcgcctacatctcccga
gagatcctcaggggattggctcacctacacgcccatcatgtcatccaccgtgacatcaag
ggacaaaacgtgctgctgactgaaaacgctgaagtcaaactggtggactttggtgtgagt
gctcagctggaccggacagtaggtcgaaggaacacctttatcgggacgccatattggatg
gctcctgaggtcatcgcttgtgatgaaaacccagacgccacctacgactataggagtgac
ctgtggtcctgtggaatcacagccatcgagatggctgagggagctccccctctgtgtgac
atgcatccaatgagagccctcttcctcattcccagaaaccctccacctcgactcaagtcc
aaaaaatggtctaagaagtttttcagcttcattgagggctgcctggtgaaaaactacacc
cagcgtcctcccaccgaacagctgctcaaacaccccttcatccgggaccagcctaacgag
aggcaggtccgcatccagctcaaagaccacatcgaccgaaccaagaagaagcggggcgag
aaggatgagacggagtatgaatacagtggcagtgaagaagaggaggaagaggcatctgag
caggaaggagagccaagctccatagtcaacgtcccaggtgagtccaccctacgccgtgac
ttcattcggctgcagcaggagaacaaggagcgttcggaggcgctgcgtcgccagcagctc
cttcaggagcagcagctccgtgagcaggaggagtacaagcgacaactgctggccgagagg
cagaaacgtatcgagcagcagaaggagcagaggagacggctagaggagcaacaacggcgt
gagcgcgagatgaggaggcagcaggagcgcgagcagcgccgacgtgagcaggaggagaag
agacgcatcgaggagatggaacgacgccgcaaagaggaggaagaacgcaggagggccgag
gaggagaagaggagggccgatcgcgaacaggagtacatccgtcgtcagttggaggaggag
cagaggcacctggagattctgcagcagcagctgctccacgaacaggccatgctgctggag
tataaatggcgggagcttgaggagcagcgccaagcccagaagctccagagacagctgcag
caagagcaggcgtacctgctgtccctccagcaaaaccagaacctggatagtaacaaaaca
gcccagcaacagagcatcaaacccccacagaaccccgagcaggacaggataaatccccca
cagagccctgaaccggatacagccaaacaaccgcagagcaccgaccttgataagactcaa
aatcgcagtctggaaaaaactacagaacccaagcaacctgtcgctgacctccaaggccct
gcccctgactctgagccagtcagagaggctgatgagcgataccgaaagaacatccagggt
tctcctcaggcagctcagaccaaaccacagcagcctccggtaccaccacgctccgagtct
tcctaccccaatgggaactcggcgtctgaggcgcccgccatgcaccggcctgtggaacca
caggtccgttcccatctggctgctttaaagagcagcggcagtgtggcttcgtcaaactcc
tccgctaccgccccacccattgtgtcacggtccttaagcgagccactcgcccctagcttt
gaaaatcttcaccttcgcaacagccaggaaccccaccaacaccatcatcctccatcttca
tcgtcatcatcatcatcctcctcctcatcatcatcatccacgcctgcacgcactgaccca
caaccccacccccagcttaggccctcgccccatgaagtgaccccttcagaggaggtcccg
cccagggttcctgtcagaactacatcaaggtccccggtgttgccaaggcgagactcgcct
catcaccatggcaacgcctcacacagcagccatgctgtgcaacgcaacactgccagtgcg
gcggagcctcggctgctgtgggagcgagtggagaaactggttcccagaccaaccagtaac
accggcagcggaggctccagttcctccagcagttccagtaactccagctctcagcccggt
tctcactgcggctctggagaaaggttcagggcccgctcctcttccaaatcagagggttca
cccctccaacggccagagaatgctgggaaaaaaccagaggagaggagggacttggtcaga
ccgagcaggccagcggacctgacggctctggccaaggagctgcgtgctgttgatgacgtt
cgccccccaaataaggtgacagattactcatcctccagcgaagagtcggacaccactgat
gaagatgacgatgaagaggtagaccaggaggcaggcgaggagtcgacctctggcccggag
gactccagagctgtctcctccaggctgagtaacggagagacagagtcggtgaagactatg
attgttcacgatgaaggcgaaagtgacgcaggctcgacaccctgcaaagacagcacgctg
atcgtccgacagagtgcaggtgacaacagaaagcgtccgagccccggcccgggccaagcc
cagacccccgtccggcttgcgggcttcgccccaagtcctggctcgggctcgggcccggcc
cttggccagcacacccccagtccccaccaccatcatcaccaccaccaccatcaccccaca
cagcactcggacaggaacggctttgccggtcgcatccaccacctcccagatctgatccag
cagagccatcattcctctccctcctccactgcatccaactccccttcctcctccagcctt
gccagcccctcctccatgtcccctcagagtcccctggacaagctcggcatcctcacagag
agccaatctagtaacaacatgcagaaacacaagtcctcttcctccttcactccgttcatc
gacccacgcctcctccaagtctctccatccaccggcagcgccctcaacaacgtcggctat
gctaatgatgcccggctggcagaggcactaagggccgacccttctcggaagggctctgtg
gtcaacgttaacccggtcaacactcgcccgcaaagcgatacgccagagatccgcaaatac
aagaagagattcaactctgagatcctgtgtgcagcactctggggtgtgaaccttttggtg
ggaacagagagcggcctgatgcttttggatcgcagcggtcaggggaaagtttaccctctg
atcaacagacgacgtttccagcagatggacgtcctggagggactcaacgtcctggtcact
atatcaggtaagaagaacaagctccgtgtgtactacctgtcctggctgaggaacaagatc
ctgcacaatgaccccgaggtggagaagaagcagggctggaccaccgtgggagacctggag
ggctgcgtccactacaaagtcgtcaaatatgagaggatcaaatttttggttctggctttg
aagaactctgtggaggtctacgcctgggcacccaaaccctaccacaagttcatggccttc
aagtctttcggtgacctggtgcacaagcccctgctggtcgacctgactgtggaggaaggt
cagaggttaaaggtcatctacggttcatgttcaggcttccacgctgtggatgtcgactct
ggcgccgtctatgacatctacctacccacacacatccagaccagtatccagtctcacgcc
attatcatcttgcccaacactgacggcatcgagctgctggtgtgctacgaggacgagggc
gtttacgtcaacacctatggacgtatcaccaaggacgtggtgctgcagtggggggagatg
ccgacctcagtggcctacattcgttctaaccagatcatgggttggggagagaaggccata
gagatccgctcggtggagaccggccacctggacggcgtcttcatgcacaagagagcccag
agactcaagttcctctgtgaaagaaatgacaaggtgttcttcgcctccgtccggtccgga
ggctccagccaggtctacttcatgactcttggccgaagcaacctgctcagctggtag

DBGET integrated database retrieval system