KEGG   Larimichthys crocea (large yellow croaker): 104918316Help
Entry
104918316         CDS       T04659                                 

Gene name
ppil4
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase-like 4 isoform X1
  KO
K12735  peptidyl-prolyl cis-trans isomerase-like 4 [EC:5.2.1.8]
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
KEGG Orthology (KO) [BR:lco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lco03041]
    104918316 (ppil4)
   03110 Chaperones and folding catalysts [BR:lco03110]
    104918316 (ppil4)
Enzymes [BR:lco01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     104918316 (ppil4)
Spliceosome [BR:lco03041]
 Complex C
  Other components
   PPlases
    104918316 (ppil4)
Chaperones and folding catalysts [BR:lco03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    104918316 (ppil4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase RRM_1
Motif
Other DBs
NCBI-GeneID: 104918316
NCBI-ProteinID: XP_010728333
Position
XI
AA seq 492 aa AA seqDB search
MSPKKHSSRESGNVSMAVLLETTLGDIVIDLFTEERPKTSLNFLKLCKIKYYNYCLIHNV
QRDFIVQTGDPTGTGRGGESVYSKLYGDQAGFFDVEKAPRIRHRKKGTVSMVNNGSDQHG
SQFLITTADNLDYLDGVHTVFGEVSEGMDVLAKINETFVDKDFVPFQDIRINHTVILDDP
FDDPPNLPVPDRSPEPTKEQLDSGRIGADEVIDDTDGKGAEELEERLKEKEAKTQAILLE
MVGDLPDADMRPPENVLFVCKLNPVTTDEDLEIIFSRFGTIKSCEIIRDWKSGDSLCYAF
IEFEKQEDCEKAYFKMDNVLIDDRRIHVDFSQSVAKIKWKGKGGKYTKDDFKAYEKDVES
RSKLALKDQVKPKQDSKYDLLIEEEEVATSHQKKHKDKRHHHHSDDEDNRKSKKHKDNDD
SRRDRKMARQRSRSRSGSRSRDRDRDRDHKHSKSRGKHGKESRDKGHRDRSRSRSQSHSS
KKSKDKDRSRYR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccaaaaaacactcctctcgcgagagcgggaacgtcagcatggcggtgctcctt
gaaacgacgctgggcgatatagtgattgatttgttcacagaggagcggccgaaaacttct
ctaaacttcctgaaattatgcaagataaagtactacaactactgcctcatccacaatgtg
cagagagacttcattgtgcagactggagatcccactgggacgggccgtggtggagaatct
gtctacagcaaactgtacggggaccaggccggcttttttgatgtagagaaagcgccacgc
atcagacacaggaagaaggggacggtgtccatggtgaacaatggaagcgatcagcatggt
tctcagttccttattaccacggctgacaacttggactacctggatggcgtccatactgtg
tttggggaggtgtcagaaggcatggacgtcttggccaaaattaatgaaacttttgtggac
aaggactttgtgccatttcaggatatcaggataaaccacacagtcatcctggatgaccct
tttgatgaccctcctaacttgccagtgcctgatcgatcacctgagcccaccaaagagcag
cttgatagcggccgaatcggagcagatgaggtgatcgacgatacggatgggaaaggagct
gaggagctggaggagaggttgaaggagaaagaagccaagactcaggccatcctgctggag
atggtgggtgacctccccgacgcagatatgaggcctccagagaacgtgctgtttgtgtgc
aaactgaacccagtgaccacggacgaggacctggagatcatcttttcccgctttgggacc
ataaaaagctgtgagatcatcagagactggaagagtggagattccctctgctacgctttc
atcgagtttgaaaagcaagaagactgtgaaaaggcctacttcaaaatggacaatgtgctc
attgatgatcgacgcattcacgtagacttcagccagtcagttgcgaagatcaaatggaaa
gggaaaggtgggaaatatactaaagatgactttaaagcctacgagaaggacgtggagagc
cgatccaaactggctctcaaggatcaagtgaagcctaaacaagattcaaagtacgacctg
ctaattgaggaggaagaggtggcaacaagtcatcagaagaaacacaaggacaagaggcat
caccatcattcagatgacgaggacaacaggaagtccaaaaagcacaaggacaacgatgat
agtcggcgagataggaagatggcacgccagcgctctcgatcccgctcaggttcccgctcc
agagacagagaccgagacagagaccacaaacacagcaagtcccggggcaaacatgggaaa
gagagccgcgataaaggccacagagacaggagccggagccggagccagagccactcctcc
aagaagtccaaggataaagacaggagtagatacagatga

DBGET integrated database retrieval system