KEGG   Larimichthys crocea (large yellow croaker): 104918808Help
Entry
104918808         CDS       T04659                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04010  MAPK signaling pathway
lco04260  Cardiac muscle contraction
lco04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104918808
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104918808
   04261 Adrenergic signaling in cardiomyocytes
    104918808
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lco04040]
    104918808
Ion channels [BR:lco04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   104918808
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF716 Claudin_3 DUF373 DHHC
Motif
Other DBs
NCBI-GeneID: 104918808
NCBI-ProteinID: XP_010728970
Position
XII
AA seq 276 aa AA seqDB search
MSACGRKALTLLSSVFAISGLGLLGVAVSTDYWLYLEEGVIMPLNQSTDIKTSLHSGLWR
VCFLAGEESGRCFTITYIMPMNVQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFVLNNI
GHVRPHRTILAFVSGIFFILSGLALVVGLVLYISSINDEMLNRTKSSEAYFTYKYGWSFA
FAAISFLLTESAGVMSVYLFMKRYTAEEIYQPRHPSFYRPRLSNCSDHSGQFLHPEAWSR
GRSPSDISSEASLQMSASYPALLKCPDYDQVSSSPC
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgtgcggtaggaaggcgctgacattgctgagcagcgtttttgcaatcagcggc
ctggggctgctgggagtggcagtcagcaccgactactggttgtacctggaggagggcgtc
attatgcctctgaatcaaagcaccgacatcaagacctcgctgcactccggcctctggaga
gtctgcttcttggccggtgaggagtccggtcgttgctttaccatcacgtacatcatgccc
atgaacgtccagttgacgtcagagtccacagtaaatgtgctcaagatgatccgctcagcc
actccgttccctctcgtcagcctcttcttcatgttcatcggctttgtcctcaacaacatc
gggcacgttcgacctcatcgcaccatcctggcgtttgtctcgggaatcttcttcatcctc
tccggcctggctctggtggtgggtctggtgttgtatatctccagtataaatgatgaaatg
ctgaacaggactaagagcagtgaggcctattttacctataagtacggctggtcgtttgcc
tttgctgccatctctttcctgctcactgagagtgcaggcgtcatgtccgtctacctgttc
atgaagcgctacacagcagaggagatctaccaacctcgtcacccaagtttctaccgccct
cgtctcagcaactgctccgaccactcaggccagtttctccacccagaggcctggtcgcgt
ggacgaagtccctccgacatctccagtgaagcttcacttcagatgagcgccagctacccg
gccctcctcaaatgccccgactatgatcaggtctcgtcttcgccctgctga

DBGET integrated database retrieval system