KEGG   Larimichthys crocea (large yellow croaker): 104919859
Entry
104919859         CDS       T04659                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04080  Neuroactive ligand-receptor interaction
lco04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104919859 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104919859 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 104919859
NCBI-ProteinID: XP_010730263
Position
I
AA seq 77 aa
MNVKILTLVIVLLVSLLCSASAGPMASTEHGRELEEAATVRKMVQQNPARGGQTHRPAGW
KRRRPRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgttctgcc
agtgctggtcccatggcctccacggagcatggcagagagctggaagaggcggccacagtg
aggaaaatggtccagcaaaaccctgcaaggggcggtcagacccacagaccagccggctgg
aagaggagacgcccacggccacgtctttcccacaaggggcccatgccgttctag

DBGET integrated database retrieval system