KEGG   Larimichthys crocea (large yellow croaker): 104919970Help
Entry
104919970         CDS       T04659                                 

Gene name
mars
Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic isoform X1
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00450  Selenocompound metabolism
lco00970  Aminoacyl-tRNA biosynthesis
lco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    104919970 (mars)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    104919970 (mars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lco01007]
    104919970 (mars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lco03016]
    104919970 (mars)
Enzymes [BR:lco01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     104919970 (mars)
Amino acid related enzymes [BR:lco01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   104919970 (mars)
Transfer RNA biogenesis [BR:lco03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    104919970 (mars)
 Prokaryotic type
   Other AARSs
    104919970 (mars)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS tRNA-synt_1 GST_C_3 Anticodon_1 GST_N_3 GST_N GST_C_5 GST_C GST_C_2 HTH_23
Motif
Other DBs
NCBI-GeneID: 104919970
NCBI-ProteinID: XP_010730412
Position
VI
AA seq 931 aa AA seqDB search
MKLFVSEGNPHCLKVLAALEVTGAKCDVQYVNHEERVVPFLSRPALPALLLPSGLHLFSS
NAICRYLFEVNGQDSSELCNQWLEWEATELQPALLQALHMAVLQGKGSEVSKVLQGPLNY
LDQSLSKKNTPYLTGEAVSVADVVLWAALYPILSDSSLALGECKSVKIWFDHGAAMHSLQ
CAAQKVLQGKGLQGMKSYMQKQPAPQSSQCRDTQPCNSSPAESEEGERLVSEEEIEAAAL
TWSKSLNACPLVANRQHPILPQEGKRNLLVTSALPYVNNVPHLGNIIGCVLSADVFSRYG
RLRDWNVLFVCGTDEYGTATENKAREEGLTPQQICDKYHAVHSSIYKWFQIDFDYFGRTT
TEKQTEIAQNIFWRLHEHGFLVEDTVEQLRCESCQRFLADRFVEGTCPHCSYPEARGDQC
DKCGRLINAVELREPQCKVCRQTPVIRSSKHLFLDLPKLETQLEQWLDKSTSTGDWTANA
KQITRSWLRDGLKPRCITRDLKWGTPVPHPDFKEKVFYVWFDAPIGYLSITANYTDKWET
WWKNPHQVELYNFMAKDNVPFHSVVFPCSLLGAQDNYTLVNHLVATEYLNYEDTKFSKSR
GVGVFGDMAKDTGILSDVWRFYLLYVRPEGQDSAFSWADMATKNNSELLNNLGNFINRAG
MFVTKFFEGCVPPMELQHEDKKLLALVGWELQQYIQLMDKVKIRDALKHILNISRHGNQY
IQVNEPWKKIKGGDTERQRAGTVTGVSVNISCLLSVMLFPYMPSVSQTIRDQLNAPQSCI
NTMLQGTGAFVCALSAGHRIGTVSPLFQKLEVDQIEALKKRFGGQQPEDEPPKKKTAAQA
AASAQPATVPAPAAPAAAAEVVTVSGVDPEKAKQLTQAVAEQGEKVRALKAQKAEKAVIT
AEVAKLLDLKKQLALAEGKSPEPAPQKGKKK
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcttcgtcagtgagggcaacccgcattgcctgaaggtgttggctgctttagaa
gtgactggagctaaatgtgacgttcagtatgtcaaccacgaagagagagtggtgcccttc
cttagccgtccagccttgccagccctgcttctgcctagtggactgcacctattcagctcc
aatgccatctgccgatacctgtttgaagtaaatggacaagactcaagtgaactatgcaat
cagtggcttgaatgggaagccacagaattacagcctgcactgctacaggcccttcacatg
gcagtgctgcagggaaaaggatcagaggtgtccaaggtcctccagggacccctaaactac
ttggaccaaagcttgagcaagaagaacacgccatatttaactggggaagccgtttcagtt
gctgatgttgttttgtgggctgcgctataccccattttatctgactcttctctagcattg
ggtgaatgcaagtctgtgaagatttggtttgaccatggagctgctatgcatagtctccag
tgtgctgctcagaaagtgctgcaggggaaaggcctgcagggcatgaagagctacatgcag
aagcaacctgcccctcagagcagccagtgccgagacacacagccatgcaatagcagccct
gctgagagtgaggaaggtgagcgtttggtttcagaagaggagattgaggcagctgctctc
acctggagtaaaagtttgaacgcctgcccattggttgcaaacagacaacaccccattttg
ccacaagagggcaagcgaaacctgcttgtgaccagcgccttgccttatgtcaacaacgtc
ccccacttgggcaacatcatcggttgcgtcctcagcgctgacgtcttcagcaggtacggc
cgcctgcgagattggaacgtgctgtttgtgtgtggcacagatgagtacggcacagctacg
gagaacaaggccagagaggagggtctgaccccgcagcagatctgcgacaagtatcatgcc
gttcactccagcatctacaaatggttccagattgactttgactattttggcagaaccacc
accgagaagcagacggaaatagcccagaatattttctggcgactccacgagcatggtttc
ctcgtggaagacacggtggagcagctgcgttgtgaaagctgccagcgtttccttgctgac
cgttttgtggaaggcacctgtccccactgcagctaccccgaagctcgtggtgaccagtgt
gacaagtgtgggcggctcatcaatgccgtagagctcagggaaccccagtgtaaggtctgc
aggcagactcctgtcatccgctcctccaaacatcttttcctggacctgccaaagctggag
actcagttggagcagtggctggacaagtcaaccagcacaggagactggacagcaaatgcc
aaacagatcactcgctcctggctgagagatggactcaaacctcgctgcatcaccagggac
ctgaagtggggaacgccagtacctcatcctgactttaaagagaaggtgttctacgtgtgg
tttgacgcccccattggttatctgtccattaccgccaactacaccgacaaatgggaaacg
tggtggaagaatcctcatcaggtggagctatacaacttcatggccaaagacaatgtgcca
tttcacagtgtggtgtttccctgctccctactgggtgctcaagacaactacactctggtc
aaccaccttgttgccactgagtatctgaattacgaagacactaagttctccaagagccgt
ggcgtgggtgtgtttggtgacatggccaaggacacgggcatcctgtctgatgtgtggcgg
ttctacctcctgtacgtgcgtccagagggacaggattcagccttctcctgggccgacatg
gctacgaaaaacaactctgagctgctcaacaacttgggcaacttcatcaacagagctggc
atgtttgtcactaagttctttgagggctgtgttcctccgatggagctacagcatgaagat
aagaagctcctggctctggtgggctgggagctgcagcagtacatccagctcatggacaaa
gtcaaaatccgtgatgctctgaagcacatcctcaacatctctcgccacggcaaccaatac
attcaggtcaacgaaccttggaagaagataaagggaggagacacagaaaggcagcgtgcg
ggcacagtgaccggcgtgtctgtgaatatctcctgcttgctctcagtgatgctgtttcca
tacatgccatcggtcagccaaaccatcagggatcaactcaacgccccacagtcttgcatc
aataccatgttgcaaggcactggcgcctttgtgtgtgccttgagtgccggccaccgtatt
ggcactgtcagtccgttgttccagaagctggaggtggaccagattgaggctttgaagaag
agatttggtggacagcagcctgaagatgaaccacctaaaaaaaagacggcggctcaggct
gctgccagcgctcagcctgccactgtgccagctcctgctgctcctgctgctgctgctgag
gtggtgacggtgagcggagtggacccagagaaagccaagcagctcacacaggctgtggct
gagcagggggaaaaggtgcgagcactaaaagcccagaaggcagagaaggccgtgatcaca
gcagaggtggccaaactgttggaccttaagaaacagctggctctggctgaggggaagagc
cctgagcctgcacctcagaagggcaagaagaagtga

DBGET integrated database retrieval system