KEGG   Larimichthys crocea (large yellow croaker): 104920317
Entry
104920317         CDS       T04659                                 

Gene name
dguok
Definition
(RefSeq) deoxyguanosine kinase, mitochondrial isoform X1
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00230  Purine metabolism
lco00240  Pyrimidine metabolism
lco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104920317 (dguok)
   00240 Pyrimidine metabolism
    104920317 (dguok)
Enzymes [BR:lco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     104920317 (dguok)
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_17 Thymidylate_kin
Other DBs
NCBI-GeneID: 104920317
NCBI-ProteinID: XP_010730857
Position
III
AA seq 316 aa
MMSALCRCLLFSRVSKLKESTGLVHVMRFGFNAVQSPQWKTHSNILSAMATKSEKLNVSF
FSSSSSTKDGPARVKRVSIEGNIAVGKSTFARFLQSACSDWEVVAEPVSKWQNIESETSK
GTGAPPQTTVSNLLQMMYEDPQRWSYTFQTYSCMSRLRTQLLPPPARLLGSEGTPVQVYE
RSIYSDRYIFALNMFHLGCINSTEWTVYQDWHSLLVEQFGHQVELEGIIYLRAPPEKCME
RLKHRGRDEEKGVKLEYLDKLHVQHERWLVEKSTEIHFEKLKQIPVLQLDASVEFQSDQE
VQEQIITKVKKFFDAL
NT seq 951 nt   +upstreamnt  +downstreamnt
atgatgtctgctctgtgccgatgccttttgttcagccgtgtttctaaattaaaagaaagc
acaggtttggtacatgttatgagatttggcttcaatgcggttcaatctccacagtggaag
acacatagtaacatcctcagtgctatggctactaagtcagagaagctcaatgtttctttc
ttttcaagttcaagttcaactaaagatgggccagctcgagtgaagagagtttccatcgag
ggcaacattgctgttggaaagtcgacttttgcaagattcctgcagtcagcttgttcagac
tgggaggtggtggcagagccagtaagcaagtggcagaacattgagagtgagacctcaaag
gggacaggcgcgcccccccagactacagtcagcaaccttctgcagatgatgtacgaggac
cctcagcggtggtcgtacacgtttcagacatattcctgtatgagtcgtctgagaacgcag
ctgctgcctcctcctgctcgcctgctcggctcagagggaacacctgtccaggtgtatgag
cgctccatctacagcgacagatacatctttgccctgaacatgtttcacttgggctgtatc
aactctacagagtggacagtctatcaggactggcactctctgctggtggagcagtttgga
caccaggtggagctggagggcatcatctacctcagagccccgccagagaaatgtatggag
cgtctgaagcatcggggaagggacgaggagaaaggagtgaagctggaatatctggataag
ctgcacgttcaacatgagaggtggcttgttgagaagagcactgaaatacattttgagaag
ttgaaacagatacctgtgttacaacttgatgccagtgtggagtttcaaagtgaccaagag
gtgcaggagcaaattataaccaaggtaaagaagttcttcgatgctttgtga

DBGET integrated database retrieval system