KEGG   Larimichthys crocea (large yellow croaker): 104920512Help
Entry
104920512         CDS       T04659                                 

Definition
(RefSeq) glutathione peroxidase 1-like
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00480  Glutathione metabolism
lco00590  Arachidonic acid metabolism
lco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    104920512
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    104920512
Enzymes [BR:lco01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     104920512
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 104920512
NCBI-ProteinID: XP_010731094
Position
VI
AA seq 191 aa AA seqDB search
MAGGVKRFYGLTAKLLSGELFSFSALKGKVVLIENVASLUGTTTRDYTQMNELHSRYAAK
GLVILGVPCNQFGHQENCKNEEILNSLKYVRPGNGFEPKFQILEKVNVNGKDAHPLFVFL
KDKLRFPSDDAMALMNDPQCIIWSPVCRNDVSWNFEKFLVGPDGEPYKRYSRNFLTIDIE
PDIKELLGKIK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggctggaggcgtgaaaaggttttacgggctgacagctaagctgctgtctggagaattg
ttcagtttctctgcgctgaaggggaaagttgttctcattgagaatgtcgcgtctctttga
ggaacaacaaccagggactacactcagatgaacgagctacacagtcggtatgcggccaag
ggactcgttattctgggtgttccctgtaatcagtttggacatcaggagaactgcaagaat
gaggaaatcctgaactctctgaagtatgtccgtccagggaatgggttcgaaccaaagttc
cagatccttgagaaggtgaatgtgaatggaaaggatgcccaccccttatttgtctttctg
aaggacaagcttcgattccccagcgacgatgccatggctctcatgaatgatccacagtgc
atcatttggagtcccgtctgtaggaacgacgtctcctggaactttgagaagttcctggtc
ggtcctgatggcgagccctataagcgctacagcagaaatttcctcaccattgatattgag
ccagatattaaagagctacttgggaagatcaaataa

DBGET integrated database retrieval system