KEGG   Larimichthys crocea (large yellow croaker): 104920666Help
Entry
104920666         CDS       T04659                                 

Gene name
dock8
Definition
(RefSeq) dedicator of cytokinesis protein 8 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
KEGG Orthology (KO) [BR:lco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lco04131]
    104920666 (dock8)
Membrane trafficking [BR:lco04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    104920666 (dock8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 104920666
NCBI-ProteinID: XP_010731299
Position
III
AA seq 2092 aa AA seqDB search
MASLGSADRRAFALKINRHSSAEIRRHFGGNYGQQHSRTNSNASASAYLTVPQTYDAVEP
LDLEEFLMSQLRSGDSALMQELGDFPDDDLKVEQVEKECRTIRHSVPEDGFEVDPHVRDC
VKSYVQPWLVVSRRCQGDGWSAYSERAGLHKLLRKQTFESDFQPENPEKPVKSPTLAGLT
DDSGRTLTSSDFNLRCLTPDQRVEGLLAFSSHEELDRFNLEARQGNRHPELFALYPPADE
EDAVEIRPIPDCPKEHTGDRILVRCQAIKFEIDIEPVFATMALYDLKEKKKISENFYCDL
NSEQFKNFLKPHTPSVDHSTLARSGIFSVTYPSQDIYLVIKIEKVLQQGEISDCADPYIT
LRESDSAKNKDKLEKLRGQAETFCQRLGRYRMPFAWATVNIMEVISTATLDRDVTDSDSL
KGGKSSSIDRRAQLPRRNSERYSTMDDQLLNISAFKPATITISTIFKQEGDRLSDEDLLK
FLSEIKKTSTPQRRIKTVPGSIKLDMSPVHDTPLACLSTELIPLIPVAEKNIRPIREVLE
FPSSEVYVPHNIYRNLLYVYPQRLNFVNRLTSARNITVKIQFMSGEDPGCCLPVIFGKSG
GPEFLHEVYTPVTYHNKSPDFYEEVKLALPARLTERHHVLFTFYHISCQQKQNQSGSCET
LIGYSWLPILNNDRLQTGQFCLPIALERLPFNYSLHTPEKLPVQAPPVKWMESHKGLFNL
EVQAVSSLHTQDNHLERFFTLCHALEGGATFPLRVRDEKIPENKLEHELKLSIISLPSSS
LEPLVLFLHLVLDKLFTLIMQPMVIAGQTANLAQIAFETVVSIVNSLHNSQELIRDQQGR
NSLLATYLYWVFRLPDPPQDMHNAGSGCTIPSAESRYSTMGRATAATVGSMLLQSRMRSS
SNPDIPGPHSSAEDAEVKNILAGKGHNNPCSRMSIYVDNHQNPTGSTRPSNRKQFHEELA
LQMVVSTGVCRENAYKYAWFFFELLVKSMAQHVSYLDKHNVPRRSRFSDRFKDDITTIVS
VVTAEIGTILVKQHKEVEQAEKVNISLAFFLYDLLSLMDRGFVFQLVKNYCNQISAKSVS
MPTLISMRLEFLRILCSHEHYLNLSLFFSSPMSAPASPCPSISSQSSGSCSFQEQQRILA
LFELSQEFKQQHYLTGLLLTELSAALDMESEGGKVQRKAINAIYSLLCSHDLDHRCVKPE
VRAKVAALYLSLVGIIIDSTNYLDFTVSDTRGGKNKTGGPEDDLENVPAINQSVAMAIAG
NPFNTLGRNVLVSMASMQGKSVATLAADTSRHLLVCFLWVMKNADKNLIQRWTVDMPPSQ
LNKLLELLTICLSCFEYRGKQSTDKVSTQALQKSHQAKLQLEQALLGGMGARGEMMKRVG
GMDRTMGQREHLRWRKDLTQWRQTNDRQDKTKAELDQEALISGNLATECNLIVLDLLETI
VQAVPLSECKDSVVGGVLKVLLHSLTCNQSSTFLSHTFSTLRALVVKFGDLLFEEEAEQC
ADLCQKVLQYCSSPVDENRSQACATLYLIMRYSYSNASNFSRVKMQVTMSLASLVGKSSD
FQEEYLRRSLRTILAYAEEDAEMQNTQLPSQVDELLRNLNSILSDTVKMREFQEDPEMLM
DLMYRIAKGYQTSPDLRLTWLQNMAEKHNNRKCYTESAMCLVHAAALVAEYLSMLEDHKY
LPVGSVTFQNISPNVLEESAVSDDILSPDEDGVCSGRYFTESGLVGLLEQAAELFSNGGL
YEAVNEVYKVIIPILEAHRDFRKLASTHDKLQRAFDNIIQKGHKRMFGTYFRVGFYGAKF
GDLDEREFIYKEPGITHLPEISHRLENFYSQCFGDETLVMIKDSTPVNRKELNPNKAYIQ
ITYVEPFFDDYEMKDRLTNFEKNFNLRRFMYTTPFTKSGRPRGELNEQYKRKTILTTMHA
FPYVKTRINVIQKEEFDLTPIEVAIEDMQKKTRELAVATHREQPDAKMLQMLLQGSVGAT
VNQGPLEVAQVFLNEIPADPKLFRHHNKLRLCFKEFIMRCGEAVEKNKHLITSDQKEYQQ
ELKKNYNRLRESLRPMLERKIPELYKPIIRPRLENRDSFKRLSFRRAQEENS
NT seq 6279 nt NT seq  +upstreamnt  +downstreamnt
atggcctctctgggcagcgcagaccgacgggctttcgctctgaaaatcaacaggcactcc
tctgcagagatcagacgacacttcggtgggaattatggccagcaacacagccgaaccaac
tccaacgcttcggcctcagcgtacctcactgtgcctcagacatatgacgcagtggagccc
ttggacctggaggaattcctgatgtcgcagttaagaagtggagactcagccctgatgcag
gaacttggagacttccccgacgatgacctaaaagtggagcaggtggagaaggagtgtcgc
actattcgacactctgttcctgaagatggatttgaggtggatccacatgtgagagactgc
gtaaagagttacgtccagccttggcttgtggtctcgagaaggtgccagggggatggctgg
agcgcatattcggagcgagcaggcctacacaaactccttcggaaacagacctttgagtcc
gacttccaaccagagaacccagagaagccagtcaagtctccaactctagcggggctgact
gatgactctggccgcacactgacctcctctgactttaacttgcggtgtttgaccccggac
caaagggtggaggggcttctggccttcagcagccatgaagagttggatcgcttcaacctg
gaagcgcgacaagggaacagacatcccgagctgtttgcactgtacccaccggcagacgag
gaagatgcagtggagatccggcccatccctgactgccctaaagaacacactggagaccgc
atcctggttcgatgccaggccatcaagtttgaaattgacattgaacccgtatttgccact
atggccttgtatgacctgaaagagaagaaaaagatatcagaaaacttctactgcgatctg
aactcagaacagtttaaaaacttcttgaaacctcacactccgagtgtggatcattccacc
ctggccagatctggtattttctctgtcacctacccatcccaagatatctacctggtcatt
aagattgaaaaggttctccagcagggagagatcagtgactgtgctgacccctacatcaca
ttgagggaaagtgactctgcaaagaacaaagacaagcttgagaagctgcgaggtcaggcg
gagaccttctgccagaggctcggtcgctatcgcatgccttttgcctgggcaaccgttaat
atcatggaggtcatctcaactgctacactagaccgcgatgtaacagactctgacagctta
aaaggaggtaaatccagcagcattgatcggagagcacagcttcccaggaggaattctgaa
cgttacagtaccatggatgatcaattactcaacatttctgccttcaaacctgccaccatc
actatcagcaccatctttaaacaggagggagaccgtttgagtgacgaagacttgctcaag
tttttgtctgagatcaagaaaacctccactccacagaggagaatcaagacagtaccaggt
tccataaaactggacatgtctccagttcatgacacaccactggcatgtttgtccactgag
ctcatccctctgatacctgtggctgagaagaacattcggcccatcagagaagtgctggag
tttccatccagtgaggtttatgtccctcacaatatttacaggaaccttctctatgtctac
cctcagaggctaaactttgtcaacaggcttacatcagcgagaaacattaccgtcaaaatc
caatttatgagcggagaggacccaggctgctgtctgcctgttatttttgggaaatcaggt
ggccctgaattcttgcatgaagtctacacccctgtcacctaccataacaagtccccagac
ttctatgaggaagtgaagttggctcttccagctcgtcttacagagaggcatcacgtgctt
ttcaccttctaccacatcagctgccagcagaaacagaaccagagcggcagctgtgagacg
ctcattggatactcttggctgcccatattgaataacgaccgactgcagacaggtcagttc
tgtctgcccattgccttggagcgactaccattcaactattcactgcacacgcctgagaaa
cttcctgtacaggcccctccagtcaagtggatggagagtcacaaaggacttttcaacctc
gaggtccaggctgtatcatctttacacacacaggacaaccacctagagcgattcttcacc
ctctgccacgccctggagggtggagctacattcccattgcgggtcagagatgagaagatt
ccagagaacaagctggagcatgagttaaagctcagcatcatctccctgccctcctccagt
ttagagcctctggtcctcttcctccacctggtgttggataaactcttcaccctcattatg
cagcccatggtcatcgctggtcagaccgctaatctggcccagatagcttttgagacagtg
gtgtctattgtgaacagtcttcataacagtcaggagctgatcagggatcagcagggtagg
aacagcctcttagcaacctacctttactgggtgtttcgtctgcctgatccccctcaagac
atgcacaatgcaggttcagggtgtacgatcccttcggcagagagccgttacagtactatg
ggtcgggccacggcagccacagttggcagtatgcttctccagtccagaatgcgtagtagc
agcaaccctgacattcccggtccacactcctctgctgaagatgccgaggtcaaaaatatc
ctcgctggcaagggccacaacaacccatgcagccgcatgtccatttacgtggacaaccac
cagaaccccacaggaagcaccagaccttccaacagaaagcagtttcatgaggagttggcc
ctgcagatggtcgtcagcaccggggtctgcagagagaatgcatacaaatatgcctggttc
ttctttgagctgctggtgaaaagcatggctcagcatgtgtcttatctcgacaagcacaac
gtcccacgaagaagccgcttttctgaccgatttaaagatgacatcaccaccattgtctcc
gtggttacagcagagattgggaccattcttgtcaaacagcataaggaggtagagcaagca
gagaaagtcaacatcagcctagccttcttcctctatgacctgctgtctctcatggaccga
ggatttgtctttcaactggtgaaaaactactgcaaccagatctcagctaagagtgtgtca
atgccgacactgatcagcatgcgtctggagttcctgcgaatcctgtgcagtcatgagcat
tacctcaacctgagcctcttcttcagcagccccatgtctgctcctgcctcaccatgtcca
tctatctcctcacagagttccggctcatgtagtttccaggagcagcaaaggattttggcg
ttgtttgaactttctcaggaattcaagcagcagcactacctgactggtctgctgctgaca
gagctcagtgctgccctagacatggagtctgaagggggaaaggtccagagaaaggccatc
aatgccatctacagcctgctgtgttcccatgatcttgaccatcgctgtgttaaacccgag
gtcagagccaaggtggctgctctctacctctccctggtggggattatcatcgactctacc
aactatctggacttcactgtttctgacacacgcggcgggaaaaacaagacgggcggacct
gaggatgaccttgaaaatgtcccagccatcaatcagtctgttgccatggcgattgccggg
aaccccttcaacacgctgggacgcaatgttctcgtctccatggcatccatgcaaggtaaa
tccgtagccaccctggcagcagacaccagtcgccacctgttggtgtgtttcctttgggta
atgaagaacgctgacaagaatctgattcagcgctggactgtggatatgcctccttcgcag
ctcaacaagctgctggagctcctcactatctgcctttcctgctttgagtacaggggtaag
cagagcactgataaagtgagcacccaggccttacagaaatctcatcaggccaagctgcag
ctggaacaagccctgttggggggaatgggagcccgcggagaaatgatgaaacgggttgga
ggaatggataggaccatgggtcagagagagcacttacgatggaggaaagacctcactcag
tggagacagaccaatgacagacaggataagactaaagcagagctggaccaggaggctctg
atcagtggaaatttagccacagagtgtaaccttatagttctggacctcctggaaaccatc
gtacaggcagtgccattgtctgagtgtaaggacagcgtggttggtggggtattgaaggtg
ttactccactctctcacctgcaaccagagttccactttcctctctcacaccttcagcaca
ctcagagctcttgttgtcaagtttggggacctgttgtttgaggaggaggcagagcagtgt
gcggacctgtgccagaaggtacttcagtactgcagcagccctgtcgacgagaacaggagc
caggcctgtgccaccctctacctcatcatgagatacagctacagcaatgccagtaacttc
tcaagagtgaagatgcaggtcaccatgtctctggcctcgctggtgggcaagtcatcagac
ttccaggaggaatacttacggcgatcactccgcactatcctggcctatgcagaggaggac
gctgagatgcagaacactcagctgccctcacaggtggatgagcttctaagaaacctgaac
agtattctatcagacactgtgaagatgagggagttccaggaagatcctgagatgctcatg
gacctcatgtacaggatagcaaaggggtaccagacgtctcctgacctccgtctgacctgg
ctgcagaacatggcagagaagcacaacaacaggaagtgttacactgagtcggctatgtgt
ctggtccacgctgctgccctggtggccgaatatctcagcatgctggaagaccacaagtac
ctgcctgttggcagcgtcacctttcagaacatctcccccaacgtgctggaggagtcggcg
gtgtctgatgacatcctgtccccggacgaggatggggtgtgttcgggacgctacttcact
gagagcggtctcgtgggactgctcgagcaggctgctgagctcttcagcaatggtggtctc
tacgaggcagtgaatgaagtctacaaggtcatcataccgatcttagaggctcacagagat
ttccgaaaactggcatccacccatgacaaactacagagagcctttgataacatcattcag
aagggccataagagaatgtttggaacctatttccgggtgggtttttatggggccaagttt
ggcgacctggacgaacgggaatttatttacaaggagccagggatcacacatctgcctgag
atatcacacaggctggagaacttctacagtcagtgtttcggagatgaaacgttggtgatg
atcaaggactcgacaccagtgaacagaaaagaactcaatcctaacaaggcatacatccag
atcacatatgtggagcccttctttgatgactatgagatgaaagaccgactgacaaacttt
gagaagaacttcaatctgcggcgcttcatgtacaccacgcccttcaccaaaagcggacgg
ccgcgaggggaactcaacgagcagtacaagaggaagacgatcctcaccaccatgcacgcc
ttcccctacgtcaagactcgcatcaacgtcatccagaaagaggaatttgacctgactcct
attgaggtggccatagaggacatgcagaagaaaactagagaactagcagtcgccacacac
agagaacagcctgatgctaagatgttacagatgctgctacaaggctctgtgggagccact
gttaaccagggcccattggaggtggcgcaggtcttcctgaatgagatcccagctgacccg
aagctcttccgtcaccacaataaactgcgcttgtgtttcaaagagtttataatgagatgt
ggtgaggcagttgagaagaacaaacacctcatcacatcagaccagaaagagtaccaacag
gagctgaagaaaaactacaaccgcctgagagagagcctgaggcccatgctggagaggaag
atacccgagctctataaacccataatcaggcctcgactggagaacagggattccttcaaa
cgtttaagtttccgccgagctcaggaggaaaactcctga

DBGET integrated database retrieval system