KEGG   Larimichthys crocea (large yellow croaker): 104921868Help
Entry
104921868         CDS       T04659                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
KEGG Orthology (KO) [BR:lco00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lco01002]
    104921868
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lco04147]
    104921868
Enzymes [BR:lco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     104921868
Peptidases [BR:lco01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   104921868
Exosome [BR:lco04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   104921868
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_2 Peptidase_S9 DLH LIDHydrolase Abhydrolase_3 Thioesterase Peptidase_S15 Lipase_3
Motif
Other DBs
NCBI-GeneID: 104921868
NCBI-ProteinID: XP_010732836
Position
Un
AA seq 354 aa AA seqDB search
MRNRVVKQDGSSSAADEAQRSARVQKKEAAPSRWWLKRGLLALFVIFIVAPFSLRKLPEL
IQHLVYVHRIRLPFFVDLSHPADLSLNHTINMYLTSEEDISLGVWLTVPESQWKEAQGKD
LAWYQNSLSDGSPVFIYLHGNTGTRAATHRVGVTKVLSRLGYHVLAPDYRGFGDSTGEPT
EAGLTTDALYLYNWVKARSGNSLVVIWGHSLGTGVATNTAVKLLEQGLVFDGVMLEGTFN
SARQTISGHPFTWYYWKFPGLGYFLPEPWAENKVVFPTEENLKKMRSPILFLHSEDDHLV
PIRFAQQLYEVAASAQNAERVKLATFDGSLGYLHNGLYRDPHLPDIIKTFVQSL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaggaacagggtcgttaaacaggatggttcatcctccgcagccgacgaagctcagagg
tcagccagggtccagaagaaggaggcggcaccgtcccgatggtggctgaaaagaggctta
ttggccctctttgttatcttcattgtggcgcctttctcgctccgaaaactcccagaatta
atccagcaccttgtttatgttcacagaatcaggttgccgttctttgttgacctcagccac
cctgctgatctctcccttaatcacacgatcaacatgtacttaacatcagaggaagatatt
tcccttggcgtatggctcactgtccctgaaagtcagtggaaagaggcacaggggaaggac
ttggcgtggtaccagaacagtttaagcgatggcagtccagttttcatatatcttcatggg
aacacaggcacgagggcagccactcatcgggtgggagtgacgaaagtattgagtagactt
ggttaccacgtgctggcgcctgactacagagggtttggagattccactggggagccgact
gaagccggtctgaccactgatgccctctacttgtacaactgggtcaaagcacgcagtgga
aacagcctggtggtcatctggggacactctcttggcactggagtggctactaacactgca
gtaaaactgcttgagcaaggattggtttttgatggtgtaatgctggagggcacattcaat
agtgctcgacagacgatatcaggtcatccttttacatggtattactggaaatttccaggc
ttggggtactttttgccagaaccatgggcggaaaacaaagtagtctttcctaccgaagaa
aacctgaagaaaatgagaagcccaatccttttccttcattcagaggacgatcatttagtt
cccattcggtttgctcagcagttgtatgaggtagcagcgagtgcccagaatgcagagcga
gtcaagctggcaacatttgacggttctctggggtacctgcacaacggcctatatagagat
ccccatctgcctgacatcataaagacgtttgtgcagtcgttgtaa

DBGET integrated database retrieval system