KEGG   Larimichthys crocea (large yellow croaker): 104922470
Entry
104922470         CDS       T04659                                 

Gene name
dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00230  Purine metabolism
lco00240  Pyrimidine metabolism
lco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104922470 (dck)
   00240 Pyrimidine metabolism
    104922470 (dck)
Enzymes [BR:lco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     104922470 (dck)
SSDB
Motif
Pfam: dNK AAA_18 AAA_17
Other DBs
NCBI-GeneID: 104922470
NCBI-ProteinID: XP_027137756
Position
IX
AA seq 267 aa
MSFTPKRPCPEPLNDSMNDSMEKTIKRISIEGNIAAGKSTFVRLLEQESGDWEVVPEPIA
RWCNVQTKGSDFEELTTSQRSGGNVLQMMYEKPERWAYTFQSYACISRVRAQIRSANGKL
REAENPVQFFERSIYSDRYIFAANLYESECLNETEWSVYQDWHGWLHSQFGKNIELDGII
YLRAAPERCLERLHLRGREEEQDIPLEYLEKLHFKHESWLQHKTMSMEFEYLSDVPVLTI
DVNEDFKGNKTKSADMIEKVKEFLSTL
NT seq 804 nt   +upstreamnt  +downstreamnt
atgtcttttactccaaagagaccgtgtcctgaaccactgaacgactccatgaacgactcc
atggagaagacaataaagcggatatcaatcgagggaaacatcgcggcgggcaaatctacc
tttgtccgccttttggagcaggagagcggggactgggaggtggtaccagaaccaatcgcc
agatggtgcaatgtccaaacaaaaggcagtgactttgaggagctgaccacatctcagagg
agtggaggaaacgttttgcagatgatgtatgagaaaccagagaggtgggcctacaccttc
cagagctacgcctgcatcagccgggtgcgcgctcagatccgctccgccaacgggaagctc
cgagaagcggagaatcccgtgcagttcttcgagcggtccatctacagtgacaggtacatt
tttgcagccaatctctacgagagcgagtgtctgaatgagacagaatggtctgtgtaccag
gactggcatggctggctgcacagccagtttggcaagaacatcgagttagacggtataatc
tacctgagggctgcaccagagagatgcttagagcgtttgcacctgagaggcagagaagaa
gagcaagacatccccttggagtatctggagaaactgcactttaagcacgagagctggctg
cagcacaagactatgagcatggagtttgagtatctaagtgacgtgccagtcttgaccata
gacgtgaatgaagacttcaaggggaataaaaccaagtccgctgacatgattgagaaggtg
aaggagttcttgagcacattgtaa

DBGET integrated database retrieval system