KEGG   Larimichthys crocea (large yellow croaker): 104922886Help
Entry
104922886         CDS       T04659                                 

Definition
(RefSeq) atrial natriuretic peptide receptor 2 isoform X1
  KO
K12324  atrial natriuretic peptide receptor B [EC:4.6.1.2]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00230  Purine metabolism
lco01100  Metabolic pathways
lco04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104922886
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104922886
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lco01001]
    104922886
Enzymes [BR:lco01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     104922886
Protein kinases [BR:lco01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   104922886
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA Adeno_E3_CR2
Motif
Other DBs
NCBI-GeneID: 104922886
NCBI-ProteinID: XP_010734139
Position
IV
AA seq 1052 aa AA seqDB search
MGCRSALGCCLLAALSCCLLPGCRGNITVAVMLPDNHHKYPWALPRVFPAILMAHEDLHA
KHGLLIGRHIRILNYSTEDPAAGSCAESRAQVAAVDAKLYIRPDAFFGPGCVYPLASVGR
FASHWKLPLITAGGPAYGFDKREEYRTIVRSGPSTTKLGDFANVLHTHFNWTSRAVVIFH
DLRQDDRPHYFLSEGIFLNLKEEMNITVEAQPYEDDYKHYKDLIAFMKEHGRIVYVCGPL
ETFLSIMKLFQSEIQDPENYAIFYLDVYAESLVDRKPWQNSDSDWADPIKVFKSVFVITY
RPPDNPEYKDFQRKLHAKAQRDFGVHLEPSLMDYIAGSFYDGFVLYARALEETLAEGGAQ
NDGINITMRTQNRRFWGVTGLVTTDHKNARDIDVNLWAMTNQETGEYGLVAYYNGTIKEI
IWSQTEKIHWPTGGPPLDNPPCVFSTDDPSCNDGHLPVLGIVAVGSGLALIIFGISSFLI
YRKLKLEKELAGMLWRIRWEDLQFESPNKYHKRAGSRLTLSQRGSSYGSLITAHGKYQLF
AKTGYFKGNLVAIKHVNKKRIELTRQVLLELKHMRDVQFNHLTRFIGACIDPPNICIVTE
YCPRGSLQDILENESINLDWMFRYSLINDIVKGMNYLHNSYIGCHGNLKSSNCVVDSRFV
LKITDYGLASFRSSCENDDSHALYASSPEKLWTAPELLIYDRHPPQGTQKGDVYSFGVIL
QEIALRNGPFYVEGMDLSPKEIVQKVRNGQKPYFRPTTDNRCHSEELTILMEGCWAEDPA
ERPDFGHIKIYVAKLNKEGSTSILNNLLSRMEQYANNLENLVEERTQAYLEEKRKAENLL
YQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFD
AIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIAGMSLALLEQVRTFKIRHRPNDQL
RLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSSATKEVLDEFGY
FDLQLRGDIEMKGKGKMRTYWLLGEKTDVYVI
NT seq 3159 nt NT seq  +upstreamnt  +downstreamnt
atgggatgcagaagtgcgctgggatgctgcctgctcgcagcgctgtcctgctgcctcctc
cctggctgcagaggaaacataaccgtggcggtgatgctcccggataaccaccacaagtat
ccgtgggctctgccgcgcgtcttcccggccatcctcatggcgcacgaggacctgcacgct
aaacacgggctgctgatcggtcgccacatcaggatcctgaactacagcaccgaggacccc
gccgcgggttcgtgcgccgaaagtcgggcacaggtggcggccgtagacgcaaagctttac
atccgcccggacgctttcttcggacccgggtgcgtgtacccgcttgcctccgtgggtcgt
ttcgcgtcccactggaaactcccgctgatcacagccggaggacccgcgtacgggttcgac
aagcgagaggaataccggaccatcgtgcgcagcgggccgtccaccaccaagctgggggac
tttgccaacgtcctgcacacgcacttcaactggacatcccgggccgtggtgatcttccac
gacctgaggcaggacgaccggccgcactactttctgtcggaagggatcttcctgaacctg
aaggaggagatgaacatcacggtggaggctcagccgtacgaggacgactacaagcactac
aaggatctgattgctttcatgaaggagcacggaagaattgtgtacgtctgcgggcccctg
gagactttcctgagcatcatgaaactgtttcaaagcgagatccaggacccagaaaactac
gccattttctatctggacgtgtatgccgagagcttggtggatcgcaaaccatggcagaac
tcagactcagactgggctgatcccatcaaggtctttaagtctgtcttcgtcataacgtac
cggcctcctgataatccagagtacaaagacttccagaggaaactccatgccaaggctcag
agggatttcggtgtgcatttggaaccatcactgatggactacatcgccggcagcttctat
gacggtttcgtgctgtacgcaagggccctggaggagacactggcagaaggtggagcccag
aacgacggcattaacatcacgatgaggacgcagaaccgtcgattctggggagtgacagga
cttgttaccacagaccacaaaaatgccagggatatagatgtgaacctgtgggcgatgacc
aatcaggagacaggagagtacgggcttgttgcatactacaatggaaccatcaaagagatc
atttggtcccaaacagagaagattcattggcccactggcggcccaccgctggataaccct
ccctgtgtgttttccacagatgatccctcctgcaatgatggtcatctccctgttctcggt
attgtggctgtgggatccggcttagcgctcatcatttttggtatctccagtttcctcatt
tacaggaaactgaagctggagaaggagctggctggaatgctgtggaggattcggtgggag
gaccttcagttcgagagccccaataaataccacaagcgagccggcagtcggctaaccctc
tcacagagaggctccagctatggctccttgataactgcccatggaaaatatcagctattt
gcaaaaacgggctattttaaggggaacctggtggccatcaagcatgtcaacaagaagagg
atagagctgaccagacaggtcttactggaactcaaacatatgagagacgttcagttcaac
catctaaccaggttcatcggagcctgcattgaccctcccaacatctgcatcgtaacagag
tactgtcccagaggcagcctgcaggacattttggagaatgagagcatcaacctggactgg
atgttccgctactcgctgatcaatgacatagtgaagggaatgaactatctccacaacagc
tacattggctgccatggaaatctgaagtcatctaattgtgtggtggacagtcgatttgtt
ttgaaaatcacggattatggcttggccagcttccgttcatcctgcgaaaatgatgactcg
cacgcactctatgcaagttctccagagaagctgtggacggctccggagctgctcatatac
gaccgccatcctcctcaagggactcagaagggtgatgtgtacagttttggcgtcatactg
caggaaatagccctgaggaatggacctttctatgtggaaggcatggacctcagccccaaa
gagattgtacagaaggtgaggaatggtcagaagccgtactttcggccaaccacggacaac
agatgccactcggaggagctgaccatcctgatggagggctgctgggccgaggaccccgcg
gagaggcctgactttggccacatcaagatctacgtggccaaactgaacaaggagggcagc
accagtattctcaacaacctgctgtcgaggatggagcagtacgccaataacctggagaac
ctggtggaggagcgaacacaagcctacctggaggagaaaaggaaagccgaaaacctcctc
tatcaaattttaccgcattcagtagcagagcagctcaagcgaggggagacggtgcaggcg
gaagcattcgacagtgtcacgatttacttcagcgacattgtgggcttcacatccatgtct
gcagagagtacaccgctacaggttgtcacattgcttaatgatctgtacacctgctttgat
gccatcatcgataactttgatgtatacaaggtggagaccattggtgacgcctacatggtg
gtgtcagggctgccggtgcgcaacggtaaactgcatgccagagagatcgctgggatgtcg
ctggcgttgttagaacaggtcagaacattcaagatccgacacagacccaacgaccagctg
agactcaggataggtatacacacaggtccggtctgtgccggtgtggtcggtttgaaaatg
cccagatactgtttgtttggagatactgtcaacacggcatctcgaatggagtccaacgga
gaagccttaaagatccatgtatcctcggccaccaaagaagtgctggatgagtttggctac
tttgatctccagttacgaggagacatagaaatgaagggcaaaggcaaaatgagaacgtat
tggcttcttggggagaagactgatgtgtatgttatctga

DBGET integrated database retrieval system