KEGG   Larimichthys crocea (large yellow croaker): 104923091
Entry
104923091         CDS       T04659                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
KEGG Orthology (KO) [BR:lco00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lco01002]
    104923091 (adamts13)
Enzymes [BR:lco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     104923091 (adamts13)
Peptidases and inhibitors [BR:lco01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   104923091 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin TSP1_CCN Reprolysin_4 Reprolysin_3 TSP1_spondin Reprolysin_5 ADAM_spacer1 Reprolysin_2 CUB Peptidase_M10
Other DBs
NCBI-GeneID: 104923091
NCBI-ProteinID: XP_019130182
Position
III
AA seq 1371 aa
MVFMTLLLSVLFLRPGLAALMSSPLVEIFHHSLHQKDTVSSPGSSPDVSASGRLRRAAVM
PDITHLELLVVVGPDVQQVHKQDTERYILTNLNIASELLRDMTLGANMRVHLVRMIILSE
PEPEIQMSTNITSSLRSVCDWGRRINPSNDTDPLHADLLLYITRYDLVLPDGNKQVRGVT
QLGGACSNEWSCVIAEDTGFDLGITITHEIGHSFGINHDGVGNTCSMSGFMMASDGGYNS
VDLTWSPCSRQQLLSFFSEGEAECVKDLPALGGSLQDWKPGLYYGVDDQCRIAFGRSARA
CTFTSPDLPACRVLSCHINPDDDSSCKRLLVPLLDGTECAPNQWCLKGHCVSPNELSSPV
VVNGSWSGWSEFTPCSRSCGGGVTHRTRKCNNPRPAFGGNDCEGPDIEAELCHQQPCERT
QLDFMAEQCSQTDLHPLYLLPNTASFYTWIPAVGFAKGDEQCRYMCQSDGENFIVSRGSQ
FVDGTRCESDSPPPFGSTAACLRGRCQLFGCDGALHSGKVKDVCGVCGGDGSSCSLTSDS
YTGGQAKEYTTFLSLPVNATQVHITNRAPLFTHMAVTVGDRYIVSGSGSIALNVTHPSLL
DDDRLEYRLHLTLDLLPEMEELLLPGPLQEEINVQVYRKYGKEYGERTNPNISYHFYVPT
RKSNLTDITPKRKWVVFTTPCSVSCGSGVQQHIYVCVDEATNNHLEERNCETPPPTIPLH
TTCQLSPCPPRWETGTFGPCSALCGGGERVRPVRCVQKHGADVVKVPDSECSPDTAPNTV
EKCNLQHCPARWRVSEPGECSAVCGPGEAKRNVSCVRSEGGQDVKVDQNLCSEEIKPADS
VPCVVDVCPIGWESKGEEQPVLKSGLLPRSRQAPVYVWSPVISHCSKTCGNGTLQVWFSC
VDHQTRLGVPDFHCDASTKPPPHSEACNTSPCPPVWHSKQGVCSVRCGGGVAIRVMYCAR
EAGEEWWEVLEDSECRDVPKPTAVVSCNTHSCPARWKVFRTSPCSASCDLGIAQRAVSCV
QSVHGKETVVPEENCHAAVKPATAVPCLVQVCTVRWELKPWSQCSVPCGYGIQSRAVSCM
GPSKTEPLSPVLCMHMPKPITIQGCKMGSCREEGSLLSVTVGRTDTPPPDTPPPTEAVTI
PQTTTTAIPTPKPSVCGQLLLEESGTVDLKDAAGRCTVSIGRPLDEVISVKVESGSLSCS
KKEFVAFFDRLAFIKKCRLVEGSELTTRTNVLLVRQHLRTPGNGIVFTYSSQKNTKKSHH
QNCDIQMFSPSGLFENPTTSSTNHTCRVLINAPPSVKIRIQALHIGLTFNSTNSQSTYIM
IRDMDVLKTNVFKGQQLFLWHSSGNMAEIEFHGDYLHSKGSFRAEYSFMQR
NT seq 4116 nt   +upstreamnt  +downstreamnt
atggtttttatgactctgctgctcagtgtgctgttcctgcgacctggcctcgccgctcta
atgagttctccattggtagagatttttcatcactccctccatcagaaagacacagtttcc
tctcctggttcttcccctgacgtctcagcgagcgggcggctgcgtcgggcggctgtgatg
cctgatatcacacatctggaactgctggtggtggtagggcctgatgtgcagcaggtccac
aagcaggatacagagcgatacatcctcaccaacctcaacattgcctcagagctgttgaga
gacatgaccttgggcgccaacatgcgggtgcacctggtccgcatgatcatcctgtcagag
ccagagccagagatccaaatgtccaccaacattacctcttctctcagaagtgtgtgtgac
tggggcagaaggataaacccctcgaacgacacagacccgctacacgctgatctcctgttg
tacattacaaggtacgacctggtgctgcctgatgggaataagcaggtgaggggtgtgacg
cagctgggtggcgcttgctctaatgagtggagctgtgtgatcgcagaggacacgggtttc
gacctgggaatcaccatcacacatgaaattggccacagttttggaatcaaccatgatgga
gtaggaaacacctgcagcatgagcgggttcatgatggcctctgatggaggctacaacagt
gtggatctgacctggtccccgtgcagcagacagcagctgctctcattcttcagtgaaggt
gaagctgaatgtgtaaaagacctccccgctctcggaggctccctacaagactggaagcct
ggtctgtattatggcgttgatgaccagtgccgtatagctttcggccgctctgcaagagcg
tgcacgttcaccagccctgacctgccagcttgtcgtgttctgtcctgtcacattaacccc
gatgatgacagttcctgcaaacgtctccttgttccactgctggatgggacagagtgtgca
cctaatcagtggtgcttaaaggggcattgtgtgtccccgaatgagctcagctcccctgtg
gtggtgaacggctcctggtctggctggtcagagtttaccccctgctcacggtcgtgtggt
gggggagtcactcatcgtacacgtaaatgcaacaacccaagacctgcttttggagggaat
gattgtgaggggccggatattgaggctgaactttgtcaccagcagccatgtgagcgcacc
cagctggatttcatggcagagcagtgctcccaaactgacctccaccccctctacctgcta
ccaaacaccgcctccttctacacctggatccctgctgtaggttttgcaaaaggtgatgag
cagtgccggtatatgtgccagtcagatggagaaaacttcatagtgagccgtggctctcag
tttgtggacgggactcgctgtgagtcagacagccctcctccctttggctccacagctgct
tgcctaagagggagatgtcagctgtttggctgtgatggtgcgctgcactctgggaaagtg
aaggatgtgtgcggggtgtgtggtggagatggatcatcctgcagtttgacgtctgactcc
tacaccggtggtcaggccaaagagtacaccaccttcctctctctgccggtgaatgccaca
caggttcatatcaccaacagggcgcctctcttcactcacatggctgtaacggttggagac
cggtacatcgtgtctgggagcggcagcattgcactgaatgtgacccacccctccctgctg
gatgatgaccgcctggagtatcgcctccacctgacccttgaccttttgcctgagatggag
gagctgctgctgcccggaccgctgcaggaggagataaacgtgcaggtctaccgcaaatat
ggaaaagaatacggagagaggacgaatccaaacattagctatcacttctacgtacccacc
agaaagagcaacttgacagacatcacacctaaacgcaaatgggtcgtcttcacgacaccc
tgctctgtctcctgtggatcaggtgtacagcagcacatatacgtttgtgtagatgaagct
accaacaaccacttggaggaacgcaactgtgaaacacctcctccaaccattccgctccac
acaacctgtcagctctctccgtgccctcccaggtgggagacggggacgtttgggccttgt
agcgccttgtgcggtggaggagagagagtgcgtcctgtgagatgtgttcagaaacacgga
gcagacgtggtgaaggttccagattctgaatgctcacctgacacagctccgaatacggtt
gaaaaatgtaacctgcagcactgtcctgccaggtggcgcgtgtcagagccaggggagtgt
tcagcagtgtgcgggccaggagaagccaaacgcaacgtgtcatgtgtgcggtcagagggc
ggtcaagacgtcaaagtggatcagaacttatgttcagaggagatcaaaccggctgattct
gtgccctgtgtggtcgatgtttgccccattgggtgggaatctaagggagaggaacagcct
gtgctgaagtctggtttgttgccacgatccagacaggctccggtgtacgtctggagtcct
gttatcagtcactgctcaaagacctgcggcaacggaaccctgcaggtgtggttttcctgc
gtggaccaccagaccagactcggggtgcctgacttccactgcgacgcttctaccaaacct
cctcctcactctgaggcctgcaacacgtcgccctgccctcctgtgtggcactctaagcaa
ggagtctgcagtgtaaggtgtggaggaggggtggccatcagggtgatgtactgtgctcga
gaagcgggagaagagtggtgggaggtgctggaggattcagagtgcagagacgttcccaaa
cccacagcagtggtttcatgtaacactcacagctgcccggcaaggtggaaagtattcaga
acatctccctgttcggcgtcctgtgatctgggtatcgctcagcgggctgtgtcttgcgtc
cagtccgttcacggcaaagagactgtggtgccggaggagaactgccacgcagctgtgaaa
ccagccaccgcagtgccctgcctggtgcaggtctgcaccgtcagatgggagctgaaacca
tggagccagtgttcagtaccctgtggatacgggatccagtccagagccgtgtcctgcatg
ggcccctctaagacggagcccctcagccctgtgctttgcatgcacatgcccaagcccatc
acaatccagggctgcaagatgggcagctgcagagaggagggatctctgttgtctgtcact
gtgggccgcacagatacaccaccacccgatacacctcctccaacagaggccgtcaccatc
ccacagaccaccacaacagccattcccacgcctaaacccagtgtatgtggacagctactt
ctggaagaatcaggcacggtggacctgaaagatgcagccggccgctgcacagtgtccata
ggtcgccccctggatgaagtcatttctgttaaagtggaatctggctccttgagctgcagc
aaaaaggagtttgttgcatttttcgaccggctggcattcataaagaagtgccggctggta
gaaggtagcgaactgaccaccaggaccaacgtcctgctggtgcgtcaacatctgcgcacc
cctggaaacgggattgtgttcacctacagctcgcagaagaacacgaagaagagccaccat
cagaactgtgacattcaaatgttttccccgagtggactctttgaaaatccaaccacgtcc
agcactaaccacacctgtcgagtcctcatcaacgcccctccctcagtgaagatcagaatc
caagcgctgcacataggattaacattcaactccaccaactcccagtctacgtacatcatg
atccgggacatggacgtcctaaagaccaacgtgtttaaaggccagcagctgtttctgtgg
cactcctctggaaatatggccgagattgaatttcacggagactacctgcattccaagggg
agcttcagagccgaatattcatttatgcagcgctga

DBGET integrated database retrieval system