KEGG   Larimichthys crocea (large yellow croaker): 104924209Help
Entry
104924209         CDS       T04659                                 

Gene name
gpx3
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00480  Glutathione metabolism
lco00590  Arachidonic acid metabolism
lco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    104924209 (gpx3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    104924209 (gpx3)
Enzymes [BR:lco01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     104924209 (gpx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 104924209
NCBI-ProteinID: XP_010735783
Position
I
AA seq 227 aa AA seqDB search
MSGKDGLMWPVLPLLLLGLLRPCTAGVPFTQQCESATDKTIYQYSARTLNGSRTVNFSDY
VGKSVLFVNVATYUGYTFQYVELNALHEEMKPLGLTILGFPCNQFGKQEPGQKHEILPGL
KHVRPGNGFVPNFLLFEKCDVNGNSEQEVFTFLKNSCPPVGDNFGDPTNRLFWQPLKTSD
IKWNFEKFLVGPDGKPVMRWHPSVNISEVRSDIRKYLLKLFTRDIFN
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggaaaggacggactgatgtggcctgttttaccgctgctgctgctcggtttgctg
cgaccctgcaccgccggagtcccattcacacagcagtgtgagtcagccacagataagacc
atttaccaatacagtgccaggactctaaacgggagtcgcactgtgaacttcagtgactac
gtgggcaagagtgtcctcttcgtcaacgtggccacatactgaggatacaccttccagtat
gtggaactgaatgcactacatgaggaaatgaaacctcttggactcaccatcctcggcttt
ccctgcaaccaatttgggaaacaggaacccgggcagaaacacgaaattctgccaggttta
aagcatgtcagaccaggcaacggatttgttccaaacttcctgctgtttgaaaaatgtgac
gtgaatggaaatagcgagcaagaggttttcacttttctcaagaactcctgccctccagtc
ggagacaacttcggtgaccccaccaacagattgttctggcagcctctgaagacgagcgac
atcaagtggaacttcgagaagtttctggtgggcccagacgggaagccagtgatgaggtgg
cacccaagtgtcaacatttccgaagtccgatctgacatccgcaaatacctgctaaaacta
tttacaagggatattttcaattag

DBGET integrated database retrieval system