KEGG   Larimichthys crocea (large yellow croaker): 104925006Help
Entry
104925006         CDS       T04659                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II delta 1 chain isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04012  ErbB signaling pathway
lco04020  Calcium signaling pathway
lco04114  Oocyte meiosis
lco04217  Necroptosis
lco04261  Adrenergic signaling in cardiomyocytes
lco04310  Wnt signaling pathway
lco04912  GnRH signaling pathway
lco04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104925006
   04310 Wnt signaling pathway
    104925006
   04020 Calcium signaling pathway
    104925006
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104925006
   04217 Necroptosis
    104925006
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    104925006
   04916 Melanogenesis
    104925006
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104925006
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lco01001]
    104925006
Enzymes [BR:lco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     104925006
Protein kinases [BR:lco01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   104925006
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 104925006
NCBI-ProteinID: XP_027143865
Position
XIV
AA seq 520 aa AA seqDB search
MASTTCTRFTDEYQLYEELGKGAFSVVRRCMKISTGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPAKRVTATDALKHPWICQRSTVASMMHRQETVECLKKFNARRKLK
GAILTTMLATRNFSAAKSLLNKKPDGVKINNKANVVTSPKEPVPTPSLEPQTTVIHNPAD
GNKESSESANTTIEDEDVRAYLLSMKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLT
SFEPEALGNLVEGTDFHRFYFDNALPKVKQPIHTILLNPHVHLIGDEAACIAYIRLTQYI
DSSGMPRTMQSEETRIWHRRDSKWQNIHFHRSGSPTIPTN
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaacgacctgcaccaggttcactgatgagtaccagctgtacgaggagctgggg
aagggagcgttctccgtggtcagacggtgcatgaagatttccacagggcaggaatacgcc
gccaaaataatcaacaccaagaagctgtctgccagggatcaccagaagctggagcgcgag
gccaggatctgccgcctgctcaagcatcccaacatcgtgcggctccatgacagcatatca
gaggaaggattccactatctggtctttgacttagttaccggcggtgagttgtttgaggac
attgttgccagggagtactacagcgaagcggatgccagtcattgcattcagcagatccta
gaggctgtgctccactgccaccagatgggcgtggtccaccgcgacctcaagccagagaat
ttactcctagccagcaagttgaagggggcggcggttaaactggcagactttggcctggcc
attgaagtgcagggagatcagcaggcatggtttggttttgctggcacaccaggatacctg
tctccagaggtgctgagaaaagatccctacggcaagccagtggacatgtgggcctgcggt
gtgattctctacatccttctagtgggatatcctccattctgggatgaggaccagcacaga
ctctaccagcagattaaggctggggcttatgatttcccttctcctgagtgggacacggtg
actccagaggccaaagacctgatcaacaagatgctgaccatcaatccagctaagagagtg
actgctacagatgctcttaaacacccctggatctgccaacgctccactgtggcatccatg
atgcacagacaggagactgtggagtgcctgaagaagttcaacgccagaaggaaactcaag
ggtgctatcctgactaccatgctcgccactcgcaacttctcagcagccaagagcctgctg
aacaaaaaaccagatggtgtcaaaatcaacaacaaggccaatgtggtcaccagccccaaa
gagcctgtccccactccttctctggagcctcaaaccactgttatccacaacccagctgat
ggaaacaaggagtccagcgagagcgccaacactaccatcgaggacgaggacgtgagagct
tacctacttagcatgaaagctcgtaagcaggagatcattaaagtcaccgagcagctgatc
gaggccatcaacaacggcgactttgaggcctacacgaagatctgtgatcctggcctcact
tcctttgagcctgaggccctgggtaacctggtggagggcactgacttccaccgcttctac
tttgacaatgctctgcccaaggtgaagcaacccatccacaccatcctgctcaacccccat
gtccacctgatcggggacgaggccgcctgcatcgcctacatccgcctcacccagtacatc
gacagcagcggcatgcctcgcaccatgcagtcggaggagacccgcatctggcaccgccgc
gacagcaagtggcagaacatccacttccaccgctccggctcgcccaccatccccaccaac
tga

DBGET integrated database retrieval system