KEGG   Larimichthys crocea (large yellow croaker): 104925045Help
Entry
104925045         CDS       T04659                                 

Gene name
parp6
Definition
(RefSeq) poly [ADP-ribose] polymerase 6 isoform X1
  KO
K15258  poly [ADP-ribose] polymerase 6/8 [EC:2.4.2.30]
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
KEGG Orthology (KO) [BR:lco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    104925045 (parp6)
Enzymes [BR:lco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     104925045 (parp6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP ARTD15_N
Motif
Other DBs
NCBI-GeneID: 104925045
NCBI-ProteinID: XP_027136871
Position
VIII
AA seq 646 aa AA seqDB search
MAFSQCVGPQDIKGQCWTDEESDGENESEQFLYGIQGSCAADLYRHPQLDADIEAVKDIY
TDSAVSVREYGTIDDVDIDLHINIGFLDEEVATAWKVIRTEPIILRLRFSLSQYLDGPEP
SVEVFQPSNKEGFSLGLQLKKILSTFTSQQWKHLSNEFLKAQQEKRHSWFKAGGTIKKFR
AGLSIFSPIPKSPSFPLIQDTVLKGKLSVPELRVTRLMNRSISCTMKNPKGELFSYPPNS
QTVAVPAARAPAQITTRQLIELFFSSQAGGHCKNIPTLEYGFLVQIMKYSEQRIPTLNEY
CVVCDEQHVFQNGSMLKPAVCTRELCVFSFYTLGVMSGAAEEVATGAEVVDLLVAMCRAA
LESPRKSIIFEPYPSVVDPNDPKTLAFNPKKKNYERLQKALDSVMSIREMTQGSYLEIKK
QMDKLDPLAHPLLQWIISSNRSHIVKLPLSRQLKFMHTSHQFLLLSSPPAKEARFRTAKK
LYGSTFAFHGSHIENWHSVLRNGLVNASYTKLQLHGAAYGKGIYLSPISSISFGYSGMGK
GQHRMPTKDELVQRYNRMNTIPQSRPIQSRFLQSRNLNCIALCEVITSKDLQKHGNIWVC
PVSDHVCTRFFFVYEDGQVGDANINTQEPKVQKEIMRVIGTQIYSS
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggccttttcacaatgtgtgggcccacaggacatcaaaggccagtgttggacagacgag
gagtcagacggggagaacgaatcggaacagttcttgtatggcattcaggggagctgtgct
gctgacctgtaccgccaccctcaactggatgcagatattgaggcagtaaaagacatctac
actgacagcgctgtctctgtgagggagtatggaaccattgatgacgtggacatcgatctt
catataaacatcggtttcttagatgaggaggttgcgacagcttggaaagttatcagaaca
gagcccattattctgagactgcgcttttctctttctcagtacctcgatggacctgaaccg
tcggtggaagtgttccagccctccaataaagaaggcttcagcctgggcctgcagctaaaa
aagatcctgagcacgttcacctcccagcagtggaagcacctcagtaatgagttcctcaag
gcccagcaggagaagaggcacagctggttcaaagctggaggaaccatcaagaagttccgt
gccggactcagcatcttttcccccatacccaagtctccaagttttcctctgatccaagac
acggttttaaaagggaagctgagtgtccctgagctgagagtgacccgcctgatgaaccgc
tctatctcatgtaccatgaagaatcctaaaggagagctcttcagctatccaccaaacagc
cagactgtggctgtcccggcggccagggccccagcgcagattaccacgaggcagctgatt
gaattgtttttctcatcccaggcgggcggccactgcaagaacatccctaccttggagtat
ggcttcttagtgcagataatgaagtactcagagcagaggatccccacgctcaacgagtac
tgcgtggtgtgtgacgaacagcatgtctttcagaatggatccatgctgaagccagctgtg
tgcacaagggagctgtgtgtgttctccttctacactctgggtgtgatgtccggagctgca
gaggaagtggccactggagcagaggttgtggacctgcttgtggctatgtgtcgagctgct
cttgagtctccccgtaagagcatcatctttgagccctacccatcagttgttgatcccaat
gaccccaagacactggccttcaacccaaagaagaagaattatgagagactgcagaaagca
ctggacagcgtcatgtccattcgggaaatgacccagggctcatatctagagatcaagaaa
cagatggacaaacttgaccctctggcccatcctttgctacagtggattatttccagtaac
aggtcccatattgtcaagctgcctctgagtaggcaactgaaattcatgcacacctcccac
cagttcctgctgctcagcagccccccggccaaggaggctcgttttcgcactgccaagaag
ctatacggcagcacctttgccttccatggttcccatatagagaactggcactctgttctg
agaaatggactagtcaatgcctcttataccaaactgcagctgcatggggcagcgtatgga
aagggcatctatctgagccccatctccagcatatcttttggatactcaggaatggggaaa
ggacagcaccgcatgcccaccaaagatgaactggtgcagcgttacaaccgaatgaatacc
ataccacagagccgtccaatacaatcgaggtttcttcagagtcgaaatctgaactgcatc
gccctgtgtgaagtgatcacatccaaggatctgcagaaacacggcaacatttgggtgtgt
ccagtttccgaccacgtctgtactcgcttcttttttgtgtacgaggatggccaagtagga
gatgccaacatcaacacccaggagcctaaggtgcagaaggagatcatgcgtgtgattggg
acccagatctactccagctaa

DBGET integrated database retrieval system