KEGG   Larimichthys crocea (large yellow croaker): 104925141Help
Entry
104925141         CDS       T04659                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK2 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
KEGG Orthology (KO) [BR:lco00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lco01001]
    104925141
   01009 Protein phosphatases and associated proteins [BR:lco01009]
    104925141
Enzymes [BR:lco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104925141
Protein kinases [BR:lco01001]
 Serine/threonine kinases: Other
  Wnk family
   104925141
Protein phosphatases and associated proteins [BR:lco01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104925141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 104925141
NCBI-ProteinID: XP_027134682
Position
VI
AA seq 2338 aa AA seqDB search
MDSVDDSRKDPPLGSTFFSAPNLDSDINANARRPVYENGTDHNIQNAALRGASDPSAYPS
TDYQGMIRQRFIRRSLWVTDSEEHPVDTPECVNNTPVLTIDLRTIVDRSRTRVLQGTRLG
LGETSSTESQVELKDSATESVSADEEKGDRTEAEPKAEVVPSDVTGKALSDENEEEPGTK
AVSTSPGGRFLKFDIELGRGSFKTVYKGLDTDTWVEVAWCELQERKLSKAERQRFKEEAE
MLKALQHPNIVRFYDFWESPVKGKKCIVLVTELMTSGTLKTYLKRFKVMKPKVLRSWCRQ
ILKGLHFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFM
APEMYEEHYDEAVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGVKPASYSKVSDP
EIKEIIGECICHRWEERYSIKDLLNHAFFAEDTGVRVEINEEDDGKKSSIALKLWVEDPK
KLKGKYKDTGAIEFTFDLVSEVPEVVAQEMVESGFFLDCDVKIVGKSIRDRVALIKWRRE
RTVSPGNGEPAVKKTQQNLLQVPGTGVQQAATLVTTDYEDQEVEQQTLICTVPATSSTTS
ESGPSSTMQLDDLNNQQNSPYQSLPEPVSTAQMIYSPPAQVDPQLHQGPYQQPTAQASQE
NYTQTSTQLHQGAYQQTTGQLHLGAYQQPAPQLHQGSYQSQTTVSAPATPAPIVHQSRQT
AQSFPAAAPTLQPQLTAQPSQEQCHLQPAAVLPQLLSGDQPTSHLSPPDISSSFPQSVSS
APPPLLPLQISTQFPSPYPVVQTGGIKPPPFPLGPLPCAYTSSGPPVSSSHYSPSPHHPS
LPLTPHAAFPSMPTLGTPQTPLSTPQHVPNVALPTPLFAMGMSPAVSQQQGGLITSQTNL
SSFHTTHPLPLSQVQPTPYPAPYPEQELAEQPVQVQAIAPQGNLGDVHLLSSVHPVLPAH
LWGSGVDTETTAPGLDLTVAPTAPVPAPASISVQVETQAPAQTPALVAAQNQPPVPAQAV
AMPQTPASTHVKDPTSVQALASAPVQAPVSASGPTFEPPKSSSTSSDATSAVDKPKLLVP
GLSSAPIPITLPASVESAAAAHAPTPVAASVPAPVLQPAGIQTAASVSECSSLATTQQNL
EQTSASSSFQQEPCVEDVYQDKPVSLPSYTYDSLNSDVASGKETSDGYDSLASGGKGDGK
PRKHHRKSARTRSRQEKTSKPKLSMLNVSNTGDKMVECQLETHNHKMVTFKFDLDGDAPE
EIATYMVENGFILMLEKEVFIDQLKDIVDKAEDMLNEDTEGERASTLSCSPQQGQISEGL
VGESQQPGAPQPVYQQNVLHTGKRWFIICPVEETPTSSQETPSDGTTTQSPGSSANTQPA
DGGTARPSASREEGSSSTMSGGSGGFTYDVYGFCSPPIMSNTDPLLFASLSPPVSAPPTL
QSVSSAEPPGSLAQPTVHQSQPARAQTLPPSSPHTSFPVEESQGSPLGSSSPIHAAHQMP
DITCPVSIADEVPCCPLVMPLSLDVSGLQAGSPLTPLPLQEPGSAKEPLSVSYTSAARSD
RPQQPVVLHQPFSSVGGTKVPSLPQSPAPSQHGAGPGESDGEGRLGRGGFVDSTIKTLDE
KLRNLLYQEYAPMYPSGSTAETPGSGTEYIQSPPGPDSATGGSGNSTPGPMGEGRYRAGE
QLPQIPERMDSLSTLSDSAVCASLSRRHLPHSASCSGTRGRFKIISVPPEVANRRDVKQR
SWSSAASPAHPVGYSVDHVQAEAMTASTTIGRFSVVSTEDDITQRTRHSRYSAPPDFYLD
TPPTMAKRSSLPHNLTSPSVPVDITVHARFLSSDSGAESSPAKLAPATPSQHTRTERRGS
DLMKRAVAFLRRSGRSSSVQSSDSPSRHGGVHGSAYGSSDNDSEMEDSDMKKELQRLREK
HLREISELQANQRGEVELLYRRLGKPPPPGLGLIAPHAGRRKRSSKHRLKPGKLLSPLVQ
QFRNVTTKSSDSSKSSAATGTGEPTVSLNGSPAKGSFPTHGRARSCTSHLPSSTSEPVQT
QQPCSLKGSLSSDNIYAGLHGDGTNTQAPPGQGDRQQRILNCWSNYPQTSERVTYKSSSK
PRARFLSGPVSLSIWSTLKRLCLGKERGSRSGAGPGPFNQSQQPPTGATPPSHQPVIGLA
QAQANNSNNKTGTYTSVSMSAYENNLPEDLQRLMDDWAQEVLIVTHRPRTNSLSISGQQL
WDQVVPRTHGQLADASDVSSWTASGPEACSLPLTWSDSPGSTMMTSPSTGPHHSYLLHSP
ATCKASPLSVTQWPGFLFPLPPSHSGVFVFPAVPSAQDAPSPISAPSYQPSDPKARTL
NT seq 7017 nt NT seq  +upstreamnt  +downstreamnt
atggattcggtggacgattcaagaaaagatccaccactgggatccacatttttctcagca
cccaatctagactcggacattaatgcaaatgcccgcaggcctgtttatgagaatgggaca
gaccacaacatccaaaacgcagccctacgaggcgccagtgacccaagcgcatacccctcc
acagactaccaggggatgatacgccagaggttcatccggcggagcttgtgggtgacagac
tccgaggagcacccggtggatacgccggaatgtgtcaacaacaccccggtgctcactatt
gacctgcggaccatcgttgatcggagtcggacccgggttctgcaaggaacccggctgggc
ctcggggagacttcaagcacggagagccaggtggagctgaaggacagcgccacagagagc
gtgagcgccgacgaggagaagggagacaggactgaagccgagccaaaggcagaggtcgtg
ccctcggatgtcacaggtaaagcattaagtgacgagaacgaagaggaaccagggacgaag
gctgtgtccacctcacctggagggcgcttcctcaagtttgacattgagctggggagaggg
tccttcaagaccgtatataaaggtcttgacaccgacacgtgggtcgaagtggcatggtgt
gaactccaggaacggaaactgtctaaagctgaaagacaaaggtttaaagaggaggcagag
atgttaaaggctctccagcaccccaacattgtgcgattttatgacttctgggaatctccg
gttaaagggaagaagtgcatcgttctggtgacagagctaatgacctcagggacactaaaa
acgtatctgaagcgttttaaggtgatgaagcctaaagttcttaggagctggtgcaggcag
attctcaaaggcctccacttcctccacacaaggactcctccaatcatccacagagacctt
aagtgtgacaacatcttcatcactggtcctacaggatctgtcaaaataggagacctgggc
ctggcaacactgaagagggcctcctttgctaaaagtgttattggcactccagagttcatg
gccccagagatgtacgaggagcactatgatgaggctgtggatgtctacgcctttgggatg
tgtatgctggagatggcgacctcagaatacccctactctgagtgtcagaatgctgctcag
atctaccgcaaagtcactagtggcgtgaaacctgccagctacagtaaagtcagtgatcca
gaaattaaggaaataattggggaatgtatctgtcacagatgggaagaaaggtactccatc
aaggacctcctgaatcatgcattctttgcagaggatacaggcgtgagagtggagatcaat
gaagaggacgatggaaagaaatcatctattgctctgaagctgtgggttgaggatcctaaa
aagctgaagggaaagtacaaggacactggtgccattgagtttacttttgacttggtgagc
gaggtaccagaggtcgttgcccaggaaatggtggaatcaggttttttcctagactgtgat
gtgaagatagtagggaagtccatccgtgaccgcgtggctctcatcaaatggaggagggag
cggactgtctcgccaggaaatggtgagccagctgtgaagaagacacagcagaacctgctg
caggtgcccggtaccggtgtacaacaggcggccacattagttacaacggattatgaggac
caggaggtggagcagcagaccctgatctgcaccgtgccagccaccagttctaccacatct
gaaagtggaccgagctctaccatgcaattggatgatctaaataatcagcaaaatagcccc
tatcagtcgcttccagagcccgtttccacagcacagatgatctacagtcctcctgcacag
gttgaccctcaactgcaccaggggccctaccagcaacccacagcacaggcctcacaagaa
aactacacacaaacatccactcaattacaccagggagcctaccagcaaaccacaggtcag
ctgcatcttggggcttatcaacaacctgctccacaactgcaccaggggtcctatcagtct
caaacaacagtttctgctccagctacaccagcccctattgtgcaccagagtagacagaca
gcacagagcttcccagctgcagcccccactctacagccacagcttactgcccaacccagc
caggagcagtgccatctccaaccagctgccgtcctaccccagcttttgtctggtgaccag
cctacatctcacctgagtcctcctgacatatcctccagttttccacagtcagtctccagt
gctcctcccccactcctgcccctacagatcagcacacagtttccctcaccatatcccgtt
gttcaaacagggggcatcaagccccctcccttccctttaggtcctctgccatgtgcctac
accagcagtggccctcctgtgtctagctcccactactcaccttcaccccaccatccctcc
cttcctctgacccctcatgctgcctttccctctatgcctactctcggcacccctcagacc
cctctgtcaacacctcagcacgtgcccaatgtggcactccctactccactttttgccatg
ggcatgtcccctgcagtgtcccagcagcagggcggccttatcacatctcagacaaacctt
agtagcttccataccacccatccattacctctctcccaggtacaacccaccccatacccc
gccccctaccctgagcaggaactggctgagcagcctgtccaggtacaggcgattgcacca
caggggaatttgggagatgttcatcttttgtcttcggtccaccctgtcttacctgctcac
ctctggggaagtggagtagatacagagactactgcacctggcctagacttaactgtagcc
cctacagctccagtcccagccccagcctcaatctcagtccaagtcgaaactcaagcccca
gcacaaactccagctctggtcgcagcacaaaaccaaccaccagtcccagctcaagctgta
gccatgcctcaaactccagcttcaacccatgtcaaagacccaacttcagtgcaagctcta
gcctcagccccagttcaagcaccagtctctgcatcaggccccacttttgaaccaccaaaa
agctcatctacaagctcagacgcaacttccgcagttgataaacctaaactcttagtccca
ggtttatcctctgccccgatccctatcacactgccagcctcagttgaatctgcagccgct
gctcatgctccaactcctgtcgcagcttcagtcccagctccagttctgcagcctgctggc
atccagacagcagcctcagtgtctgagtgttccagcctggccacaactcagcaaaacctc
gagcagacatctgcatccagctcctttcaacaggagccctgtgtagaggatgtgtatcag
gacaaaccagtatctttacccagttatacctatgacagtctcaactctgatgtggcatct
ggtaaggaaacaagcgatggctatgacagcctggctagtggagggaagggggacggaaaa
cccaggaaacaccaccgcaagtctgcccgcacacgttcccgtcaagaaaagaccagcaaa
cccaaactgagcatgcttaatgtttccaacactggtgataaaatggtggaatgccagctg
gagactcacaatcacaaaatggtgacatttaaatttgatctggatggagatgccccggag
gaaatagctacttacatggtagagaatggctttatcctgatgttagagaaggaggtcttc
attgaccagctaaaggacattgtggataaagctgaagacatgctgaatgaagacacagag
ggtgaaagagcatccaccttgagttgtagccctcaacaaggccaaatttctgaaggtctg
gtaggagagagtcagcagcctggagcaccccagcctgtctatcagcagaatgttcttcat
acagggaagagatggttcataatctgcccggtagaggagacgcccacatccagccaggag
acaccatctgatggcacaactacgcagtctcctgggagttcagccaatacccagccagct
gacggtggcactgcaaggccgtctgcatccagagaagaggggtcgtcctccacaatgtct
ggtggaagtggaggcttcacctatgatgtgtatggattctgtagccctccaataatgtcc
aacacagaccctctcctcttcgctagtctgtcacctcctgtgtctgctcccccgaccctt
cagtcagtgtcatcagcggagcctccagggagtttggcgcagccgactgttcaccagtcc
cagccagccagagctcaaactttgcccccgtcatccccacatacgtctttcccggttgag
gagtcacaagggtcccctttgggatccagttccccgatccatgcagctcatcagatgccc
gacataacatgtcctgtttcaatagctgacgaggtaccctgctgccctctggttatgccc
ctgtctctggatgtgagcggtttacaggcgggttctcctctcaccccacttccacttcag
gagccaggttcagccaaagaaccgctgtctgtttcctacacctctgcagcgcggagtgat
cgcccacagcagcctgtggtgctccaccagcccttttccagcgtgggagggaccaaagtg
ccctcacttccccagagccctgcaccatcccagcatggtgcagggcctggtgagtcagat
ggcgaaggacggctgggccgtgggggatttgtggacagcaccataaaaacactggatgaa
aaattaaggaacttgctctaccaggaatatgctcccatgtatccatcaggcagtacagca
gagaccccgggctccggcaccgagtacatccagtctcctcctggtccagacagcgccaca
ggaggatcaggaaacagcacaccagggccgatgggtgagggacgctacagagcaggagaa
cagctgcctcaaattccagagagaatggatagtttgagcacactgagtgactcagccgtg
tgtgcttccttgtcaagaagacaccttcctcactctgcatcctgctccggaacaagaggc
agatttaagataatctctgttcctcctgaagtggccaacagacgggatgtgaagcaaagg
agctggagcagtgctgcctcacccgcacaccctgtaggatacagcgtggaccacgttcag
gcggaggccatgactgcctccaccacgattggccgtttctctgtggtgagcactgaagat
gacattacacaaaggacacgtcacagccgctactctgccccgcctgatttctacctggac
acacctcccaccatggccaagcggagctccctgcctcacaatctgacctcaccctctgtc
cctgtggatatcacggtccatgctcgtttcctctcgtcggactcgggggccgagagcagc
cctgcaaaactggctccggccactccgtcccaacatactcgcaccgagcgcagaggaagt
gacctcatgaagagggcagtggccttcctccgtcgctcagggcgcagcagcagtgtgcag
agctctgactcaccaagtaggcatggaggcgtgcatggctcagcctatggcagcagcgat
aatgactcagagatggaagactcagacatgaaaaaggaactacagagactcagggagaaa
catctgagggagatatctgagctgcaggccaatcaacggggggaagtggagctgctgtat
cgacggcttggcaaaccacctcctcctggcctgggactcattgcaccacatgccggccgt
agaaagaggtccagcaagcacagactgaagcctggcaaacttctcagccccctggttcaa
cagtttagaaatgtcacaaccaaaagtagtgactccagcaaatccagtgctgctacaggt
acaggtgagcccacagtgagtttaaatggctctccagccaaagggtcttttcccactcat
ggcagggcacggtcatgcaccagccaccttcctagctcaacctcagagccagtgcagact
cagcagccctgttccctcaagggctctttgtcttctgataatatttacgccggacttcat
ggagatggcaccaacacacaagctccacctggacaaggtgaccgccagcaacgtatacta
aattgctggtctaattaccctcaaacgtctgagagagtgacctataaatcgagtagcaag
ccacgagctagatttctcagtgggcctgtgtctttgtctatctggtcaacactgaagcga
ttgtgtctcggcaaagagcgtggcagcaggtctggagctgggccagggcctttcaatcaa
tcacagcagccacctaccggtgcaacgcctccttctcatcagccagtaataggactggcc
caagctcaggccaataacagcaacaacaagacaggcacatacactagcgtatccatgagt
gcctatgaaaacaacctgcctgaagacttgcaacggctgatggacgactgggcccaggag
gttcttattgtcacccacaggccgcgcactaactctctgagtatcagcgggcagcagctt
tgggatcaggttgtgcctcgaacacatggacaactggctgatgcttcagatgtatcatca
tggacagcctcaggtccagaggcctgcagtcttcccctaacatggtcagacagccccggg
tcaacaatgatgaccagcccctccacagggccccaccacagttatctgctacactctcct
gctacgtgcaaggcctcacctctttctgttacccagtggcctgggttcctcttccccctt
cccccttctcattcaggggtctttgtctttcctgctgtgccctcagcccaggatgccccc
agccccatttcagctccatcgtatcagccgtccgaccctaaagctaggactctctaa

DBGET integrated database retrieval system