KEGG   Larimichthys crocea (large yellow croaker): 104926328
Entry
104926328         CDS       T04659                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00100  Steroid biosynthesis
lco01100  Metabolic pathways
Module
lco_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    104926328 (tm7sf2)
Enzymes [BR:lco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     104926328 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT DUF4083 PEMT
Other DBs
NCBI-GeneID: 104926328
NCBI-ProteinID: XP_010738462
Position
XXII
AA seq 425 aa
MRPNSQELKRKSSHDTEREFGGTLGAIGIPIFLPLTVLFLISTSRSPEASVLQWPPSLPS
TDQLWDPLALVVLLCWIALHALLYLTPLGKVSEGLVLRDGTRLKYPINGFHGLCITGVLL
MFLVGLGAPLGYLFELLLPLAVCAIAVSFLFSVYLYIRSFLAPSHALALGGNTGNPLYDF
FIGRELNPRIGNFDLKYFCELRPGLIGWVVINLGMLMKEVELRGSPSLAMILVNSFQLLY
VADALWNEEAVLTTMDIVHDGFGFMLVFGDLAWVPFTYSLQASFLVVHPQAISSFRAAII
IALNGIGYYIFRKSNSQKNQFRRDPSHPSVARLETIATATGKRLLVSGWWGLVRHPNYLG
DLLMALAWSLPCGFSHLLPYFYVIYFTVLLIHREDRDERQCRTKYGLAWDTYCRRVPYRI
FPYLY
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgaggccaaacagtcaagaactcaaacgcaaatcctcccatgacacagagagggaattt
ggaggaacccttggtgccataggcatccccatcttccttccattgacggtgctgttcctg
atctctacgagtcgatcccctgaggccagtgtgctccagtggcccccttccctccccagc
actgaccagctgtgggaccctctggccctcgtggttctgctgtgttggatcgctctgcat
gctctcctctatttgacgccgttaggaaaggtgtctgaaggattagtgctgagggatgga
acacgtctcaagtatcccataaatggttttcatggcctgtgcatcactggtgtgctgctg
atgtttttagtggggctgggggctcctctggggtatctgtttgaactcctgttgcctctg
gcagtgtgcgctatagcagtgtcgttcctgttctccgtctacctctacatccgctccttt
ttggctccttctcacgctctcgctttggggggcaacacaggaaatccactgtatgacttc
tttatcggacgggaactaaaccctcggattggaaactttgaccttaaatatttctgtgag
ctcagaccgggtctgatcggctgggtggtcataaacctcggcatgctgatgaaggaggtg
gaacttcgcggttccccctcattagccatgatactggtcaacagtttccagctgctgtat
gtggcagacgctctgtggaacgaggaggctgttctgacaaccatggacattgtgcacgat
ggtttcggcttcatgctggtcttcggggacctggcctgggttccctttacatacagccta
caggctagctttctggtcgtacatccacaggcaataagttccttcagagcggcaataata
atagcactgaatggtatcggatattatattttcaggaaatccaactcacagaagaaccag
ttcagacgagacccttcacatccaagtgttgcaagactggagaccatcgccacagcaaca
gggaaacgcctcctggtgtccgggtggtggggtctcgttcgtcatcccaattacctcggt
gacctcctcatggctctggcgtggtccctgccatgtggattctcacatctcctgccttac
ttctacgtcatatatttcaccgtcttgctgattcatagagaggaccgggatgagagacaa
tgtaggaccaagtatggactagcgtgggatacctactgtcgacgtgtcccctacaggatc
ttcccttatctatactga

DBGET integrated database retrieval system