KEGG   Larimichthys crocea (large yellow croaker): 104926343Help
Entry
104926343         CDS       T04659                                 

Definition
(RefSeq) histamine N-methyltransferase
  KO
K00546  histamine N-methyltransferase [EC:2.1.1.8]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00340  Histidine metabolism
lco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    104926343
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lco04147]
    104926343
Enzymes [BR:lco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     104926343
Exosome [BR:lco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104926343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_16 DUF1073
Motif
Other DBs
NCBI-GeneID: 104926343
NCBI-ProteinID: XP_010738481
Position
XVIII
AA seq 287 aa AA seqDB search
MAEQTCYEGSAVQSFQFYLEHSGEHKAILQHIPDILPGEFKRIAADKSSLDVMGVGSGGG
EVDVKILTMLQSTLPAVPITADIVEGSSELTDNFRALVAKTTNLQKIPFVWHIMSSEDYE
RQVKAKGDMKRFNFIHMIQMIYYVDSLADTIKFYHSLLKNNGTLMIIIETADGGWDTLWK
TYKKDLCVHPITEYRSSSEVIACVKSQGLKYEEHIIPNSFDITECFNPGSPTGERLLNYM
TAKDNFNESFTPETRAGILDLLKNKCSTEKDGRVLFNSTMSCILIHA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcaaacctgttatgagggcagtgctgtccaaagctttcagttctacctagaa
cattcaggagaacacaaggctattctccagcatattccagacatcctgcctggagaattt
aaaagaattgcagctgataagagcagcctggatgttatgggtgttgggagtggtggaggg
gaggtcgatgtcaagatactcaccatgctgcagtctacattgcctgctgtcccgatcact
gctgacatagtggagggcagctctgagcttacagacaacttcagagctttggtagcaaag
accaccaaccttcagaagatcccatttgtttggcacatcatgagcagtgaggactatgag
aggcaagtcaaagcaaagggagacatgaagagattcaacttcatacacatgattcagatg
atctactatgtggatagcctcgctgatacaatcaagttctaccacagcctcttgaagaac
aacggcacgttaatgatcatcattgaaacagctgatggtggctgggacaccctgtggaag
acgtacaagaaggatctctgcgtccaccccatcacggagtaccgctcatcaagtgaggtt
attgcctgtgtgaagagccagggtctgaagtatgaggagcacatcattcccaacagcttc
gacatcactgagtgcttcaatccaggcagcccgactggagaacgtctgctgaattacatg
acagcaaaagacaactttaatgagtccttcactcctgagaccagagcaggcattttagac
cttctcaagaacaagtgcagcactgaaaaagatggcagggtcctcttcaacagtactatg
agctgcatactcattcatgcttga

DBGET integrated database retrieval system