KEGG   Larimichthys crocea (large yellow croaker): 104926754Help
Entry
104926754         CDS       T04659                                 

Definition
(RefSeq) heat shock 70 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco03040  Spliceosome
lco04010  MAPK signaling pathway
lco04141  Protein processing in endoplasmic reticulum
lco04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:lco00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    104926754
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104926754
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104926754
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104926754
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lco01009]
    104926754
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lco03041]
    104926754
   03009 Ribosome biogenesis [BR:lco03009]
    104926754
   03110 Chaperones and folding catalysts [BR:lco03110]
    104926754
   04131 Membrane trafficking [BR:lco04131]
    104926754
   03051 Proteasome [BR:lco03051]
    104926754
   03029 Mitochondrial biogenesis [BR:lco03029]
    104926754
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lco04147]
    104926754
Protein phosphatases and associated proteins [BR:lco01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     104926754
Spliceosome [BR:lco03041]
 Complex B
  Other components
   Prp19 complex
    104926754
 Complex C
   Prp19-CDC5 complex
    104926754
Ribosome biogenesis [BR:lco03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    104926754
Chaperones and folding catalysts [BR:lco03110]
 Heat shock proteins
  HSP70 / DNAK
   104926754
Membrane trafficking [BR:lco04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    104926754
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    104926754
Proteasome [BR:lco03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    104926754
Mitochondrial biogenesis [BR:lco03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    104926754
Exosome [BR:lco04147]
 Exosomal proteins
  Proteins found in most exosomes
   104926754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C CRIC_ras_sig
Motif
Other DBs
NCBI-GeneID: 104926754
NCBI-ProteinID: XP_010738994
UniProt: A0A125RLA5
Position
XV
AA seq 638 aa AA seqDB search
MSAKGISIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPANTIFDAKRLIGRKFTDPVVQSDMKLWPFKVISDSGKPKVQVEYKGETKAFYPEEI
SSMVLVKMKEIAEAYLGQKVSNAVITVPAYFNDSQRQATKDAGVISGLNVLRIINEPTAA
AIAYGLDKGKRGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVN
HFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITR
ARFEELNSELFRGTLDPVEKSLQDAKLDKSKIHEIVLVGGSTRIPKIQKLLQDFFNGREL
NKSINPDEAVAYGAAVQAAILMGDTSENVQDLLLLDVAPLSLGIETAGGVMTPLIKRNTT
IPTKQTQIFSTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQVEVTFD
IDANGILNVSAVDKSTGKENKITITNDKGRLSKEEIERMVQDSEKYKADDDIQREKIAAK
NSLESYAYHMKSSVEDENMKGKISEEDKKVVIDKCKQTISWLENNQLAEKEEYEHQQNEL
EKVCKPIVTKLYQGGAPSGGCGSQAGGSSKGPTIEEVD
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctaaaggaatatctattggcattgatctgggcaccacctattcttgtgtcggg
gttttccagcatggcaaagtggagataatcgccaacgaccagggaaacagaaccactccc
agctatgtggcctttactgacacagagaggctcattggagatgctgccaagaatcaggtt
gccatgaaccccgccaacacaatctttgatgccaagcggctcatcgggagaaagtttacc
gaccctgttgtccagtctgacatgaagctctggcccttcaaagtgatcagtgatagcgga
aaacccaaagtccaagttgagtataaaggggagaccaaagccttctacccagaagaaatc
tcctccatggtcctggttaaaatgaaggagatcgctgaagcctacctgggacaaaaagtg
tcaaacgcagtcatcacagttccagcgtattttaacgactcccagaggcaagccaccaag
gacgctggggtgatctctggactgaatgttctgaggatcatcaatgaacccacagcagca
gccatcgcctacggcctggataaaggtaaaagaggggagcgcaacgtgctcatctttgat
ctcggtggaggcacctttgacgtgtccatcctgaccattgaagatggcatctttgaagtg
aaatccactgcaggcgacacacatcttggtggggaggactttgacaaccggatggtcaac
cactttgtagaggaatttaaaagaaaacacaagaaggacatcagccaaaataagagagca
gtgaggaggctgcgcactgcttgtgaaagagcaaagaggaccctgtcctccagcacccag
gctagccttgagattgactctctgtttgagggtatcgacttctacacctcaatcacaagg
gcacgctttgaggagctcaactcagagctcttcaggggaacactggatccagttgagaag
tctctgcaagatgccaagctggataagtccaagatccatgaaattgtcctggttggtggc
tccacaagaattcccaaaatccagaagctcttgcaggacttttttaatggcagagaattg
aacaagagcatcaacccagatgaagctgtggcctatggtgcagcagtccaggctgctatc
ctgatgggtgacacttcagaaaatgtccaagatttgctactgctggatgtggctcctctg
tctctgggcattgagactgcgggtggagttatgacacctttaatcaaacgaaacaccacc
atccccaccaagcagacccagatcttctctacatattcagataaccagccaggtgtgctg
attcaggtgtatgagggtgagagagccatgaccaaggacaacaacctccttggcaagttt
gagctcacaggtatccctcctgctccccgaggtgtcccacaggtggaggtaaccttcgac
attgatgccaatggaattctgaatgtgtccgctgtcgacaaaagcactggcaaagaaaac
aaaatcaccatcaccaatgacaagggccgacttagcaaagaggagatagagcgcatggta
caggactctgaaaagtacaaggctgatgatgacatacagagggagaagattgcagcaaag
aactcactggagtcatacgcctaccacatgaagagcagcgttgaggatgagaacatgaaa
ggaaagattagcgaggaggataaaaaggtggtcattgacaagtgcaagcaaacgatctcc
tggctggagaacaaccagctggcagagaaggaggagtatgaacatcaacagaatgaacta
gagaaggtgtgcaagccgattgtgaccaagttgtaccagggaggagcaccatcaggagga
tgtggcagccaggcaggaggcagctccaagggccccactattgaggaagttgactaa

DBGET integrated database retrieval system