KEGG   Larimichthys crocea (large yellow croaker): 104927116Help
Entry
104927116         CDS       T04659                                 

Gene name
cacng5
Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04010  MAPK signaling pathway
lco04260  Cardiac muscle contraction
lco04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104927116 (cacng5)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104927116 (cacng5)
   04261 Adrenergic signaling in cardiomyocytes
    104927116 (cacng5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lco04040]
    104927116 (cacng5)
Ion channels [BR:lco04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   104927116 (cacng5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF716 DUF4199 Claudin_3 DUF4131
Motif
Other DBs
NCBI-GeneID: 104927116
NCBI-ProteinID: XP_010739428
Position
X
AA seq 277 aa AA seqDB search
MSLCGRKALTLLSSVFAVCALGLLGIAVSTDYWLYLEEGVILPLNQSTEIRMSLHSGLWR
VCFLAGEEKGRCFTIEYVMPTNVQMTSESTVSVLKMIRSATPFPLVSLFFMFIAFVLSNI
GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISNINDEMLNRTKTNEAYFSYKYGWSFA
FAAISFLLTETAGVMSVYLFMKRYTAEEMYRPHQGFYRPRLSNCSDYSGQFLHPDAWAGR
GRSPSSISSEASLQMNSSNYPALLKCPEYEQMSSSPC
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagcctatgtggcaggaaggcgttgacgttgctgagcagcgtgttcgctgtttgcgcc
ctgggcctgttggggattgcagtaagcaccgactactggctctacctggaggagggtgtt
atccttcccctcaaccagagcacagagatacgcatgtccctccactctggcctctggagg
gtgtgcttcttggctggggaggagaaaggcagatgttttaccatagagtatgtgatgccc
actaatgtccagatgacctctgagtccactgttagtgtcctgaagatgatccgttctgcc
actccattcccgctggtcagccttttcttcatgttcattgcttttgtactcagcaacatc
ggccacatccgaccccatcgcaccatcctggcctttgtctctggaatcttcttcatcctg
tcaggtctctctctggtagttggtctggtgttgtacatctccaacattaatgacgaaatg
ttgaacagaaccaagactaatgaggcctacttcagttacaagtacggctggtcatttgcc
tttgctgccatctccttcctgctcactgagacggcaggtgtcatgtcggtgtacctgttc
atgaaacgctacacagcagaggaaatgtaccggcctcatcagggcttctaccggcctcgc
ctcagcaactgctcagattactctggtcagttcctccatccagacgcctgggctggacgt
ggtcgtagtccctcctccatctcttctgaggcctccctccagatgaactcttccaactat
cctgctctcctcaagtgtccagagtatgagcaaatgtcctcctcaccttgctga

DBGET integrated database retrieval system