KEGG   Larimichthys crocea (large yellow croaker): 104927913Help
Entry
104927913         CDS       T04659                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04010  MAPK signaling pathway
lco04218  Cellular senescence
lco04370  VEGF signaling pathway
lco04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104927913
   04370 VEGF signaling pathway
    104927913
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    104927913
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104927913
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lco01001]
    104927913
Enzymes [BR:lco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104927913
Protein kinases [BR:lco01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   104927913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Pkinase_fungal Choline_kinase
Motif
Other DBs
NCBI-GeneID: 104927913
NCBI-ProteinID: XP_010740401
UniProt: A0A0F8C145
Position
XV
AA seq 386 aa AA seqDB search
MSTQHQPAFPIQQQQPNLNSAPSLLPQCFVKPFHNPLQIKRNVITDDYNVTNQVLGMGIN
GRVLEIFHKESGEKFALKMLQDCPEARREVELHWRVSPCSHIVPIIDVYENLYQGRKCLL
IVMECMDGGELFSHIQDRGNHAFTEREASDIMKSIGEATHFLHTINIAHRDIKPENLLYT
SKRPDALLKLTDFGFAKEITTLNSLATPCFTPYYVAPEVLGPEKYDRSCDMWSLGVIMYI
LLCGYPPFFSHHGLAISPGMKRRILNGQYEFPNPEWSDVSEEAKQLICHLLKTEPTQRMS
ITEFINHPWINQSVEVPQTPLHTSRVLHEEQDVWEKVKEEMTNALQTMRVDYDQIKIKTI
EDSTNPLLLKRRKKTKKISSATQPPC
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactcagcaccagccggctttcccgatccaacaacagcaacccaatctgaactct
gctccttctctgctcccacaatgttttgtgaaaccctttcacaaccctctgcaaatcaag
aggaatgtaataacagacgattacaatgtaacaaatcaggtgctcgggatgggcattaat
ggcagagtgttggaaatattccacaaagagagtggagaaaagtttgcactaaagatgctg
caggattgtccagaagccagacgggaggtggagcttcattggagggtgtcaccttgttcc
cacattgtacccatcatagatgtttatgaaaatctataccagggcaggaagtgtcttctc
atcgtgatggagtgcatggatggaggtgaattattcagtcatatccaagacagagggaat
catgcttttacagaaagagaggcctctgacatcatgaaaagtattggagaagcaacacat
ttcttgcataccatcaacattgctcacagagacatcaagccagaaaacctgctgtacacc
tctaaaaggccagatgctctcctcaagctgacggattttgggtttgccaaagaaatcacc
acattaaactctttagcaacaccgtgtttcaccccatactatgttgctccagaagttctt
ggtccagagaagtatgacaggtcctgtgacatgtggtctctgggtgtcattatgtatatc
ctactttgtggatatcctccctttttctcacatcatggtttggcaatttccccgggaatg
aaaagaaggatcctcaacggacaatatgagttccccaacccggagtggtccgacgtgtct
gaggaagccaaacagctgatctgccacttattaaaaactgagcccacccagagaatgagc
atcaccgagttcataaatcacccctggattaatcagtcagtcgaggtcccacaaacgcct
cttcacaccagccgcgtgctgcacgaggagcaagatgtctgggagaaggttaaagaggaa
atgacaaatgccctgcaaacgatgagagtggactatgatcaaattaaaatcaaaactatt
gaagactcaactaatcctctactcttgaagagaagaaagaaaaccaaaaaaatatcatca
gccacacaacctccgtgctag

DBGET integrated database retrieval system