KEGG   Larimichthys crocea (large yellow croaker): 104928021Help
Entry
104928021         CDS       T04659                                 

Gene name
mgll
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00561  Glycerolipid metabolism
lco01100  Metabolic pathways
Module
lco_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    104928021 (mgll)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lco01002]
    104928021 (mgll)
Enzymes [BR:lco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     104928021 (mgll)
Peptidases [BR:lco01002]
 Serine Peptidases
  Family S33
   104928021 (mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 Peptidase_S9 DLH Abhydrolase_2 Abhydrolase_5 LIDHydrolase PGAP1 Thioesterase Ser_hydrolase DUF1350 Abhydrolase_3 PAF-AH_p_II DUF1057 FSH1
Motif
Other DBs
NCBI-GeneID: 104928021
NCBI-ProteinID: XP_010740532
Position
Un
AA seq 343 aa AA seqDB search
MNAVTAATCLLVAGFSYFLFGCDVLLPLLRASVAEPSMPEPGDAPRLSPQGVPYTDLQHI
VNADGLHLFCRYWEPAGPPRALVFIAHGAGEHCGPYDEIGQKLKELSLLVFAHDHVGHGQ
SEGDRMNIKDFQIYIRDSLQHVDLMKSRHPDLPVFIVGHSMGGAISILTACERPSDFAGV
VLIAPMVQMNPDSATPFKVFLAKVLNHMLPSLTLGSIESKWVSRDKKQVEAYDTDELNFH
GGMRVSFGMQLMGAAARIEREIPSINWPFLLLHGDADKLCDIRGSRMMHENAQSSDKKIT
IYEGGYHALHHDLPEVAESVLTEVTSWITERLPDKTSPQPQGS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctgtgaccgccgccacctgcctgctcgtcgccggcttcagctatttcctcttc
ggctgcgatgtgttgttaccgctgctccgtgcctctgttgcagagccctccatgcccgag
ccgggagatgctccgcggctgagcccgcagggagtcccatacaccgacctgcagcacatc
gtcaacgccgacggactgcacctgttctgccgctactgggagcccgccggtccgccaagg
gcgctggtgtttattgcccatggggctggagagcattgtgggccgtatgatgagattggg
cagaaactgaaggaactgtccctgctggtatttgcacatgaccatgttgggcatggccag
agtgaaggagacaggatgaacatcaaagacttccaaatctacatcagagactccctgcag
cacgttgacctgatgaagtcccgccaccctgacctgcctgtcttcattgtgggtcactcc
atgggtggtgcaatctccatcctgacagcctgtgagaggcccagtgattttgctggagtg
gttctgattgcaccgatggtccagatgaacccagactcagccacaccgttcaaggttttt
ctggcgaaggtcctgaaccacatgctgcccagcctcactctgggctccatcgagtccaaa
tgggtctcacgggacaagaagcaggtggaggcatatgacacagatgagctgaacttccac
ggcggcatgcgggtgtcgttcggcatgcagctcatgggggcggcggcacgcatcgagagg
gagatcccatccatcaactggcccttcctgctcctgcacggcgacgctgacaaactctgc
gacatcagaggctccaggatgatgcacgagaacgctcagagctctgacaagaaaatcacg
atctatgagggaggctaccacgctcttcaccacgacctcccagaagtggccgagtctgtg
ctgacagaagtgaccagctggatcacagagcgcctccctgacaagacatcgccacaacca
caaggctcgtag

DBGET integrated database retrieval system