KEGG   Larimichthys crocea (large yellow croaker): 104928493
Entry
104928493         CDS       T04659                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1 isoform X1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
KEGG Orthology (KO) [BR:lco00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lco01002]
    104928493
Enzymes [BR:lco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     104928493
Peptidases and inhibitors [BR:lco01002]
 Metallo peptidases
  Family M1
   104928493
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N Peptidase_M9_N
Other DBs
NCBI-GeneID: 104928493
NCBI-ProteinID: XP_019119289
Position
III
AA seq 985 aa
MTFNAGDVSSVFSQHALFICFTFTLGDFVLKTSQAVRGFPAFTVTMLVAPLVLLLFVSFS
PSSGAQLPNQGKVKDVPIATNGQPFPWDRMRLPKTVSPLHYDLTIHPNLTTLDFTGVARI
QLDVHQDTSTIVLHAKQLQVSNVLLLAPEGVRPLRVLEYPPFHQLALLSDSVLTKGRKYE
VQLEFAANLSDSFHGFYKSSYRTRSGEVRVLASTQFEATFARGAFPCFDEPAFKANFTIR
MIREPRHIAISNMPKVKTVDLPGGLLEDHFDTTVKMSTYLVAYIVSDFLSVSKTTQHGVK
ISVYAVPEKIDQTAFALDAAVKLLDFYDDYFDIPYPLPKQDLAAIPDFQSGAMENWGLTT
YRETGLLFDPEKSSASDKLGLTKVIAHELAHQWFGNLVTMEWWNDLWLNEGFAKFMEYIS
LDITYPELQVDDFFLGKCFEAMEVDSLSSSHPVSTDVENPTQIQEMFDDVSYDKGACILN
MLRDFLTPEAFEIGIIRYLKRYSYQNTVNSHLWESLTDICNSDDLMEGGMKHKEFCSKRK
RQSGSSKWYSGDELDVRAIMDTWTLQEGFPLVTVEVRGREVRLSQERFLKTDDPSLTEGF
LWQIPLTYMTSASNTIHRFLLKSKTDVLYLPEPVDWVKFNVDMSGYYMVHYAGEGWNSII
KVLQYNHTALTSNDRASLIHNIFQLVSIGKVRLDTALELSLYLSRETEIMPVTQGFGELV
PLYKLMEKRDMAALENQMKDYIVDLFRGLIDRQEWTDSGSVSERVLRSYLLLFGTVRNYA
PCVTKATQLFSKWKDSDGNMSLPVDVTTAAFMIGARTPEGWDFLFEKYRTSLQMSVKSRM
KSAMAFSPLQDKLKWMMEQSLHGEIMKTQDLPDVVVTVSRNPRGYKLGWDFLRANWHTMI
KKFDLGSSTISYMVNGVTNQYSTREMLDEVKSFFGSLTEETGSEMRCIRQTYETIEDNIR
WMDTNLPLLQAWLDKRSHKALHEDL
NT seq 2958 nt   +upstreamnt  +downstreamnt
atgacatttaacgcaggggacgtttcctctgttttctcccagcatgcactcttcatctgt
ttcactttcactcttggagacttcgtgctaaaaaccagccaagcggtgagagggtttcct
gctttcaccgtcaccatgttagtggctcctcttgtgctgctgttgttcgtttcattttct
ccctcatcaggagctcagctaccaaatcaaggcaaagtcaaggatgtccccatagccacc
aatggtcagccattcccctgggaccgcatgagacttcctaaaactgtttccccgctccac
tatgacctgaccatccaccccaacctgaccaccctcgacttcaccggcgttgctcgtatc
cagctggacgtgcaccaagacaccagcaccattgttcttcatgcaaagcagttgcaggta
tccaacgtgctgctcctcgcacctgaaggtgtgaggcctctccgtgttttggagtatcct
cctttccatcagctcgccctgctgtcagactcggtgctgaccaaaggtaggaagtatgaa
gttcagctggagtttgctgccaacttatctgacagcttccacggtttctacaaaagcagc
taccgcacacggagtggggaggtcagggttctggcatccacacagtttgaagccaccttt
gctcgtggagccttcccctgttttgatgagccggccttcaaagccaacttcaccatacgg
atgatacgagagccacgtcacatagccatatccaacatgcccaaggtaaaaactgtggac
ttgccaggcggtctgcttgaggatcacttcgacaccactgtgaagatgagcacttaccta
gtggcctacattgtttctgacttcctgtctgtgagcaagaccacacagcatggtgtcaag
atttcagtctatgccgtacctgagaaaatcgaccagacagcctttgcactggatgctgcc
gtcaagctgttggacttctacgatgactattttgatattccttacccgcttcccaaacag
gaccttgctgctatccctgacttccagtcaggagcgatggagaactggggtctgaccaca
tacagggagactggcctcctctttgaccctgaaaagtcctcagcttcagacaaactgggt
ctcaccaaggtcatcgcccacgagcttgcgcatcagtggtttgggaacctggtgacaatg
gagtggtggaatgacctgtggctcaatgagggtttcgccaagttcatggagtatatttct
ctcgacatcacctacccagagctgcaagtggatgacttcttcttggggaaatgtttcgag
gccatggaggtggactccctcagctcatcccacccagtctccaccgacgtggaaaatccc
acacagatccaggagatgtttgatgacgtgtcatatgacaagggggcatgtattctgaat
atgctgcgggacttccttactcctgaggcctttgagattggcatcatccgatacctcaag
cgctacagctaccaaaacactgtcaacagccacctgtgggagagcctgactgatatctgc
aactctgatgatctcatggaaggaggaatgaaacacaaagaattctgctccaagcgaaaa
cgccagtctggatcgtctaaatggtactctggtgatgaattggatgttagggccatcatg
gacacctggacgctgcaggaaggctttccactggtcactgtggaggtcagaggccgcgag
gtcaggctcagtcaggagcgctttctgaagacagacgacccctccctcactgagggattc
ctctggcagattccactgacctacatgaccagcgcctccaacaccatccaccgctttctg
ctcaagtcaaagaccgatgtcttgtacctgccggagccagtagactgggtgaagttcaat
gtggatatgagcggatactacatggtccactatgctggtgagggatggaactctattatc
aaagtgctgcaatacaaccacacagctctgaccagcaacgaccgtgccagcctcatccac
aacatcttccaattggtcagtatagggaaggtgaggctggacaccgctctggagctgtct
ctctacctgtccagagagactgagatcatgcctgtgactcagggctttggagagctcgta
cctctctacaaacttatggaaaagagagacatggctgctctggagaaccagatgaaggac
tacattgtggatctgttccgagggctcattgatcggcaggagtggactgactctggatca
gtgtctgaacgagtgctgaggagctacctgctgctgttcggcactgtcaggaactacgct
ccctgtgtgaccaaagccacccagctctttagcaagtggaaggactctgacggcaacatg
agtctccctgttgacgtcacaactgctgcatttatgattggcgctcggacaccagagggg
tgggacttcctgtttgagaaataccgtacctcactgcaaatgtctgtaaagagccgcatg
aagtctgcaatggccttcagcccactacaggacaagctcaagtggatgatggagcagagc
ctccacggtgagataatgaaaacgcaggacctcccagatgtggtcgtcactgtcagcaga
aacccccgtggctacaaactgggctgggatttcctccgagccaactggcacaccatgatc
aagaaatttgacttaggctccagcaccatatcatacatggtaaacggagtgaccaaccag
tattctactagggagatgttggatgaggtgaaaagcttctttggctccctgactgaggag
acgggctcagagatgaggtgtatccgtcagacctatgagaccattgaggacaacatccgc
tggatggacaccaaccttcctctgctgcaggcctggctggacaaacgcagccataaagcc
ttgcatgaagatttgtaa

DBGET integrated database retrieval system