KEGG   Larimichthys crocea (large yellow croaker): 104929159Help
Entry
104929159         CDS       T04659                                 

Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-2 isoform X1
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104929159
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lco04040]
    104929159
Ion channels [BR:lco04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   104929159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Motif
Other DBs
NCBI-GeneID: 104929159
NCBI-ProteinID: XP_010741908
Position
XV
AA seq 643 aa AA seqDB search
MGDMDVYKCLSLLFFTLLPQVCSQVGPRAHAEERLLKDLFVHYNKLSRPVENTTDTVLVH
FGLSIAQLIDVDEKNQMMTTNVWVKQEWNDYKLRWNPEEYENVTSIRIPSEIIWRPDIVL
YNNADGDFAVTHFTKAHLFFDGQIKWMPPAIYKSSCSIDVTFFPFDQQSCKMKFGSWTYD
RAKIDLINMASDVDQMDYWESGEWVIVNAVGKYNTKKYECCTEIYADITYYFIIRRLPLF
YTINLIIPCLLISCLTVLVFYLPSQCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPL
IGEYLLFTMVFVTLSIIITVFVLNVHHRSPQTHGMPHWVRRVFLDLVPRVLFMKRPPGTA
KQHCKKLIEMMHRPTTISATGNSQAFWSGLETGLRQMGQVENTLPKTPSDSPSILVCSPS
PPSSTLEDCNKEDHSLKASIFCQSTSGQYSILSEKQLLRGHNSAASSSSQLSLPPTLPLG
PLRTLAREEPNTLAPNGRSLSAEQMFGQQKELPQTAGHLCRSRSFQYCCLHDEGPGVIAV
AGLVKKQAPVDHLAETFTAESTKDASTQQDTMVPTISPAMQRAIEGVQYIADHLRALDAD
FSVKEDWKYVAMVIDRIFLWMFVLVCILGSVGLFLPPWLAGMI
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatatggatgtatacaaatgtttaagcttacttttcttcactcttcttccacaa
gtatgttcccaagttggaccccgtgcccatgctgaagagaggctgctcaaggatctgttc
gtacattacaataagctctccaggcctgtggaaaacaccacagacacagtgctagtccac
tttggactgtctattgcccagcttattgatgttgatgagaaaaaccagatgatgaccaca
aacgtctgggtcaagcaggaatggaatgattacaaactccgctggaacccggaggaatat
gaaaatgtcacctccatccgtattccctcagagatcatctggagaccagacattgtcctc
tacaacaatgctgatggcgactttgcagtaactcacttcacgaaggcacatctgttcttt
gacggtcagataaaatggatgccaccggccatttacaaatcctcatgcagcatagatgtg
acctttttcccttttgaccaacaaagctgcaaaatgaagtttggttcatggacctatgac
cgtgccaaaatcgatctgatcaacatggccagtgatgtggaccagatggactactgggag
agcggtgaatgggtcattgtcaatgctgtgggcaagtacaataccaaaaagtatgaatgc
tgtacagagatctacgcagatatcacttactacttcatcatccggaggcttccgttgttc
tacactataaaccttatcatcccctgtcttcttatctcctgtctgactgtgctggtgttt
tatctgccatcacaatgtggagagaagatcaccctgtgtatctcagtgttactgtcacta
acagtattcctcctgctgatcacagagattataccatccacatcgttggtgattccattg
attggtgaatacctactgtttacaatggtctttgtcacgctctccatcataattactgtg
tttgtgctaaacgtacatcaccgatcaccacaaacccatggcatgcctcactgggtgcgg
agagtattcttggacttggtgccccgagtcctcttcatgaagcgtccaccaggcacagcc
aagcagcactgcaagaagcttatcgaaatgatgcaccgccctactaccatatctgcaaca
ggtaactctcaggctttttggtcaggattagagaccgggttgagacaaatgggccaggtc
gagaacacactcccgaagactccatccgacagtccaagcattcttgtctgctcgccgtcc
ccaccctcttccactctcgaggactgcaacaaggaagatcattcactgaaggcgagcatt
ttctgccagtccacatctggtcaatattcaattctctcagagaaacaactcctacgtgga
cataactctgctgcctcgtcttcttcccaattgtccttacccccaactttaccactgggt
ccacttcggactctagccagggaagaacccaataccttggccccaaatggtcgctccctc
agtgcagagcaaatgtttggccaacagaaggagctcccccagacagctgggcatctgtgt
cgttcccgcagcttccagtactgctgtctgcatgatgaagggcctggggttattgctgtt
gcagggctggtgaagaaacaagcccctgtagatcacctggcagaaaccttcacagcagag
tccactaaagatgcaagtacccaacaagacaccatggttccaactatttccccagctatg
caacgtgccatagagggagttcaatacattgctgatcatcttagggcactggacgcagat
ttttcagtaaaggaggactggaagtatgtggctatggtcattgacaggatattcctctgg
atgtttgtactcgtgtgtatactcggatctgttggactctttctccctccttggctggct
ggaatgatctag

DBGET integrated database retrieval system