KEGG   Larimichthys crocea (large yellow croaker): 104929212Help
Entry
104929212         CDS       T04659                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:lco00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    104929212
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lco03041]
    104929212
Enzymes [BR:lco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     104929212
Spliceosome [BR:lco03041]
 Complex C
  Other components
   Step II factors
    104929212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C DEAD AAA_22 T2SSE AAA_19 Flavi_DEAD AAA_30 AAA_16 ABC_tran PhoH Sigma54_activ_2
Motif
Other DBs
NCBI-GeneID: 104929212
NCBI-ProteinID: XP_027145585
Position
XVI
AA seq 1218 aa AA seqDB search
MADGGGVDELSQLEYLSLVSKVCTELDNHLGISDKDLAEFVIDLAEKQPAFDGFKALLLQ
NGAEFTDSLIGNLLRLIQTMRPPSKASTSKASEVLVKPKSEKEKLKELFPALCRPNDPAP
KKLLDEDDVKVAADAMKELEMFMPSVSGTDSKSSKSRSEKRRHSRSRSRSREKDRHRDRD
RDRDRDRDRKRRHRSRSRSRSRSRSRDRDRHRDRDRDRGKRSNKSSRWSERSPSPRKDQD
RDSDRWKDKHVDRPPPEEPSVGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRRE
GRVANVADVVSKGQRVKVKVLSFTGSKTSLSMKDVDQETGEDLNPNRRRNVGPDGGEEIS
MRNPDRPSNLNLGHAPELEQDDTLERKRLTKISDPEKWEIKQMIAANVLSKEEFPDFDDE
TGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPVKIVKNPDGSLSQAAMMQSAL
AKERRELKQAAREAEMDSIPMGLNKHWVDPLPDADGRQIAANMRGIGMMPNDIPEWKKHA
FGGNKASYGKKTQLSILEQRESLPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYL
AEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMT
DGMLLRECLIDSELGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDA
VKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTG
QEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIA
ETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRL
YTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLY
TLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPK
DKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQM
LGIMDRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALF
NRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFSPAFFKVSDPTRLSKQKKQQRLEPLY
NRYEEPNAWRISRAFRRR
NT seq 3657 nt NT seq  +upstreamnt  +downstreamnt
atggcggacggcggaggagtggacgagctgtcccagctcgagtatctgtctctggtgtcc
aaagtctgcacggagctggacaaccatctcggaatcagcgacaaagatttagctgagttc
gtcatcgacctcgcggagaagcagccggccttcgacgggttcaaagctctgctgctgcag
aatggagccgagttcacggactctctcatcgggaacctgctcaggctcatccagactatg
cgacctccatccaaggcctccacgagcaaagcctcggaggttttggtcaagccgaagtcg
gagaaggaaaagttgaaggagctttttcccgccctgtgcagaccgaacgatccagcaccg
aagaagctgctggatgaagacgatgtgaaagtagcagccgatgccatgaaggagctggag
atgttcatgcccagtgtgagcggcacagactccaaaagcagcaagagcaggtcagagaag
agacgccacagccgaagtcgcagcagaagcagagaaaaggacagacacagagaccgagac
agggacagagacagagatcgggacaggaagaggcggcatcgctctcgctcgcgctccagg
tccagatctcgctccagagaccgcgaccgccacagagacagagacagagatcgcggcaag
agaagtaacaaatcttcccgctggagcgagcgctcaccgagccccagaaaagaccaagac
agagactctgaccgctggaaagacaaacacgtggaccgtcctccaccggaggagccgtct
gttggtgacatctacaacggcaaagtcaccagcatcatgcagtttggatgctttgtccag
ttggagggattaaggaaacgatgggagggtttggtccacatttccgagctgcgtcgagag
ggccgcgtggccaacgtggccgatgttgtcagcaaaggccaaagagtcaaagtcaaggtg
ctctcgttcaccggctccaagaccagcctcagtatgaaggatgtggaccaggagacggga
gaagacctgaatcccaacaggaggagaaacgttggcccggacggaggggaagagatctcc
atgaggaaccccgaccggccgagcaacctgaacctgggccacgccccggagctcgagcag
gacgacaccctggagcgcaagaggctcaccaagatttcagacccagagaagtgggagatc
aaacagatgatcgctgccaacgtcttgtccaaagaagagttccctgattttgacgatgag
acgggaatccttcctaaagtcgacgacgaagaggatgaagacttggagatcgagctggtt
gaagaggagccaccgttcctgaggggacacaccaagcagagcatggacatgagtcctgtg
aagatcgtcaagaatccagatggctctctgtcccaggcggccatgatgcagagcgctctg
gctaaggagagacgcgagctgaagcaggctgcacgggaggcagagatggactccatcccc
atggggctgaacaaacactgggtcgacccgctgccagacgctgatggtaggcagattgca
gccaacatgagaggcattggcatgatgcccaatgacatcccagagtggaagaagcatgct
tttggaggcaacaaggcctcttatggaaagaagacccagctctccatcctggagcagagg
gagagtctgccaatctacaagctgaaggagcagctcatccaggcggttcacgacaaccag
atcctgattgtgattggagagacggggtccggtaagaccacgcagatcactcagtacctg
gcggaggcgggttacaccaccagggggaagatcggctgcacgcagccccgtcgtgtggcc
gcgatgtctgtggccaagagagtctctgaggagtacggttgctgtctgggacaagaggtg
ggttacaccatccgatttgaggactgcaccagccctgagacggtgatcaagtacatgaca
gacggtatgctgctgagagagtgtctgatcgactccgagctgggtcagtacgccatcatc
atgttggacgaagctcacgagaggacgatccacactgacgtcctgtttggtttgctcaag
aagacggtgcagaaacgcacagacatgaagctcatcgtaacgtcagccacactggacgcc
gtgaagttctctcagtatttctacgaagctcccatcttcaccatcccaggaagaacttat
ccagtggaggttctctacaccaaagaacctgagacggactacctggacgccagtctcatc
accgttatgcagatccacctgaccgagcctccgggcgacatcctggtgtttctgactgga
caggaagagatcgacaccgcctgtgagatcctgtacgagaggatgaagtcgctcggtcct
gatgttcctgaactcatcatcctcccggtttattctgccctgcccagtgagatgcagacc
aggatctttgaccctgcacctccaggcagcagaaaggtcgtcatcgcaacaaacattgca
gagacgtctctgaccatcgatggaatctactacgtggtcgatcctggcttcgtcaaacag
aaagtgtacaactctaagacgggcatcgaccagctggtggtgactcccatctcacaggct
caggccaagcagagggcaggacgagccggcagaaccggtccagggaagtgttacagactg
tacacagagagagcctacagggacgagatgctgaccaccaacgtgcccgagatccagaga
accaacttggccagcactgtgctgtctctgaaggcgatgggcatcaacgacctgctgtcg
ttcgacttcatggacgctcctcccatggagactctgatcacagccatggagcagctctac
acgctgggagctctggacgacgaaggcttactcacacggctgggtcggcggatggcagag
tttcctctggagcccatgctgtgtaagatgttgatcatgtctgtccacctgggctgcagt
gaagagatgctcaccatcgtgtccatgctgtcagtgcaaaacgtcttctacaggcctaaa
gacaagcaggccctcgctgaccagaaaaaggcaaagtttcaccaacccgaaggcgatcac
ctgaccctgctggccgtctacaactcctggaagaacaacaagttctccaacccgtggtgt
tacgagaacttcatccaggctcgctccctgcgcagagcccaggacatccgcaaacagatg
ctgggaatcatggacagacataaactggacgtggtatcttgtggtaaagccaccgtgcgg
gtccagaaagccatctgcagtggcttcttcaggaatgcagccaaaaaggatcctcaggag
ggttaccgcacactcatagaccagcaagtcgtgtacatccacccctccagtgctctgttc
aaccgccagcctgagtgggttgtttaccacgagttggtgctgaccaccaaggagtacatg
cgggaggtgaccaccatcgacccccgctggctggtggagttctcccccgccttcttcaaa
gtgtccgaccccacgcgcctcagcaagcagaagaaacagcagcgcctcgagcctctgtac
aaccgctacgaggaacccaacgcctggaggatctctcgcgccttcagacgccgctga

DBGET integrated database retrieval system