KEGG   Larimichthys crocea (large yellow croaker): 104929264
Entry
104929264         CDS       T04659                                 

Gene name
ahrr
Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
KEGG Orthology (KO) [BR:lco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lco03000]
    104929264 (ahrr)
Transcription factors [BR:lco03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    104929264 (ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 104929264
NCBI-ProteinID: XP_010742040
Position
XXIII
AA seq 693 aa
MIPPGDCMYAGRKRRKPIQKQKPSSSSEKTNPSKRHRDRLNAELDRLASLLPFPPDVISK
LDKLSVLRLAVSYLRVKSFFQGNPDKTSRKHITSTSSSNPEPRKESLALGTGVNESSLLL
ESLTGFALVVSSDGMVFYASSTIVDYLGFHQTDVMHQNVFDYIHIDDRQEFRRQLHWAMC
PPQHQGTSAHQDNQLASGTGDDFVVNSLFHSPEAGGISPELSCFLNRCFIARVRCLLDST
SGFLTMQFQGRLKFLHGQKKKSASGALMPPQLALFCIGVPLLLPSITEMKMKNMLMRGKN
KGGGGGIISALEHGERGEHLRRHSYSGGMGDIADPLFLSCPTPGANQRGHHTPWTPLSKD
NLKYRPDGYYNQEEPLNYCKSSMASHKGVSPGLGGGWPLRPNSGPLRAGQGVGYIPSNRL
NKAGQYGKPYRLSPSCNSGRGGEVFVSKLYGNVQIPTDPDAYCVDLVKNENGYGECYDGH
LMPEMPPIKVEHDSDSENGCDPYGRPWACRDPEAINRRYGNGVYDQTSGLHLKSEADYYD
PQYSPCQRGKAGISPPYNNGNYQNYAVNNSGNTPGRVLKCDKDLANNNDNSQFSPQRLSH
SDSLCSNQSINLMDSHIYPQDPHKAYMHQDYNKHYEFKGHGLIHSIKREPMDSPPWSEST
HDISQSMMVGPRNVMPCVMSTGHHKSSPYIYMP
NT seq 2082 nt   +upstreamnt  +downstreamnt
atgatccctccgggagactgcatgtatgcgggcagaaagaggaggaagcccatccaaaaa
cagaagccgtcttcttccagtgagaaaaccaacccgtccaagcggcacagagacaggctg
aatgctgagctggaccggctggccagcctgctgccgttccccccggatgtcatctccaag
ctagacaagctgtctgtgctgcgtcttgcagtttcctacctccgcgtcaagagtttcttc
caagggaacccagataagacctccaggaagcacattaccagcacatcttcttctaaccct
gaacccaggaaagagagccttgcactgggcaccggtgtcaatgaaagcagcctcctgctg
gaatctctgacaggctttgccttggtggtgagcagtgatgggatggtcttttatgcctcc
tcaaccattgtggactatctgggatttcatcagactgacgtgatgcatcagaatgtgttt
gactacatccacatagacgaccgccaggagttcagacgccagctccactgggctatgtgt
cctccgcagcaccaggggacatcagcacaccaggacaaccagttggcatcaggcactggt
gatgactttgtagtgaacagcctgttccattctccagaggccgggggaatttctcctgag
ctctcctgctttctcaacagatgtttcattgctcgagtccgatgcctcttggacagcacc
tctggattcttgactatgcagttccagggccgactgaagttcctccacggtcagaaaaag
aagtcagcctccggggctcttatgcctccacagctggctctattctgcataggtgtaccc
ctcctactgccctccatcacagagatgaaaatgaagaacatgttaatgcggggaaagaac
aaaggaggaggaggagggattatctctgcactggagcatggtgaacgaggggaacacctc
cggaggcattcctacagtggaggaatgggtgacattgcagaccctctcttcctctcctgt
cccactcctggtgctaaccagcgaggtcaccacactccttggaccccgctctccaaagac
aacctcaagtaccgccctgatggttactacaaccaggaggagcccctcaactactgcaag
tcctccatggcttcccataaaggtgtcagcccaggcctcggcggcggctggcctctgcgg
ccgaactcaggtcccctcagagcgggccagggtgttggctacatcccctctaaccgctta
aacaaggctggtcagtatgggaagccataccgtctttcccccagctgcaacagtggcagg
ggcggcgaggtgtttgtctctaagctctacgggaatgtacagattcccacagatccagat
gcctattgtgtggacctggtgaagaacgagaacggctacggagaatgctacgatggccat
ctgatgcctgagatgccacccatcaaggtagagcacgactcggactctgagaacggctgc
gacccctacgggcgaccctgggcttgccgcgacccagaggccattaaccgtcgctatggt
aacggggtatatgaccagacctcaggcctccatctcaaatcagaggcagattactatgat
ccacagtactcaccctgtcagcgagggaaagcaggaatcagtccaccgtacaacaacggt
aactaccagaactatgcagtgaacaacagcggcaacactccaggacgtgtgttaaaatgt
gacaaagacttggccaataacaatgacaacagccagtttagtcctcagagactctcccac
tcagactctctatgcagcaaccagtctataaacctcatggactcacacatctatccacaa
gaccctcacaaggcgtacatgcaccaggactacaacaagcattatgagttcaaaggtcac
ggcttgatccattcgatcaagcgggagcccatggactccccaccatggtcagagagtact
catgacataagccagtctatgatggttggtcctaggaacgttatgccatgtgtgatgagc
acagggcaccacaagtccagtccctacatttatatgccgtaa

DBGET integrated database retrieval system