KEGG   Larimichthys crocea (large yellow croaker): 104929426
Entry
104929426         CDS       T04659                                 

Gene name
aff3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
KEGG Orthology (KO) [BR:lco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:lco03021]
    104929426 (aff3)
Transcription machinery [BR:lco03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     104929426 (aff3)
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int
Other DBs
NCBI-GeneID: 104929426
NCBI-ProteinID: XP_019119561
Position
XVIII
AA seq 1231 aa
MPTVLSGKGKLSVVCFLLRCAYSQVTRSQHNSCAKDILEDMTQSWPSQQALGGDQAQRIL
YNSKEAKLPSTHQRQSRGDVQLRMTRRPHVAPHKSMLADDLKLSSDDEDTQRVTHESSSW
DGHSLSAQRAHTHGRRVRHSSSDSSASDCSAESARSSSSSSSNLHSRSPSRSPEVNPDPP
SPANTTRPPCNSKETDRPSAAHWQLDKWLKKSQKKSSRSEQESSQSIPGRLPSPHTQRAP
SPARSWDSNQEYSPSQSPIPSPQFHYSNNNSPLPSPGYSYCPSPSPFPSTCPSPSPSPRH
SLILSPVPSVCPSPRGSPGASRSPSPIPRGPPRSPSPSLPAPSRVCHYPEVQSQNQTQPS
LTTNAHRTKNRSWIAPPPNTDTKCKPANSTHLQTPHQHRPKAQLTQKQDQSQSKPKAPAA
LNSNQSNSHKSRPKPNFHSGSKQLSEAPKAKHVPQFEQIQSSRSNQNSNHKLRPSFQSSS
QHSPTRAKHLAPTSREPNPGHSSHSQSPSKSAANSNTGLNSRSNPSLKPPRAKSCEAAAP
TPVHDNHTKATPKKPQYKEQEVEHRGEHLTQTDGRKQERKQERQKDKQQGKQERKQDRRL
AEEQLLRRPWIQSSAEEEEEEEEEEEKEEEVIERQRKREETSRGENSRRREQQHRREWQT
RPKPRQRLQDESHQQGRTKKLGRSEEEKQDPSPPSPRSSTPRIPSSSSSASSSSDSDSEP
ECRAPITKVPADSTSHKRPDPKRGTSDASGSKVVHPRGSTSGNPSEGKQKLYTLVPFGRA
EKATAPAQRGLRNLVVQIDLCLLKRVPDSTTGPVVKKAPCSSSSSSTKDKQREAMKHLYV
PETATKDGKRKRKLENGVSHKESKRSVPHTNDLSGRTESSAHTAEHSFVTETTHNGYLEE
YLDSKRPLSPLSPLSVSSESAKPPSKTKTVEQPHVHKNRDKKSDSAIKPKMEVECVKVSK
QPHPPSESWGPAGHRGTVPNHETPHHAEYYLHEAKRMKHRADAMVDKLGKAVNYMDAALS
FMECGKAMEEGPLEAKSPYTMYSETVELIRYAMRLKSHSGPGARQEDKQLAVLCFRCLAL
LYWQMFRLKKDHALKYSKVLLDYFKSSPKVPSTPPCWSDSGKGAGGLPSSLSPNAKHPRQ
GSHGGSNNLPSLISIPQRIHQMAANHLNITNSVLYSYEYWEVADNLAKENKEFFNYLNTL
SGPLTLHSSIAHAVQYTRQALQWIRISAKLN
NT seq 3696 nt   +upstreamnt  +downstreamnt
atgcctactgtcctcagtggcaaagggaaactttccgttgtgtgttttctactccgatgc
gcgtattctcaggtaacacgaagccaacacaacagctgtgccaaagatattctggaggac
atgactcagtcctggccgtcccagcaagccttagggggtgaccaggcccaacggatcctc
tacaactctaaggaggcaaaactaccaagtacacaccaaaggcaaagtcggggggatgtt
cagctgcgaatgacccgacgccctcacgtggcacctcacaaatcgatgctcgctgatgac
ctgaagctgagcagtgacgatgaggacactcagcgggtaactcatgagtcgtcttcctgg
gatggacacagcctgtcagcacagcgagcgcacacacatggcagacgggtgagacattcc
agctccgactcttcggcctctgactgctccgccgagtccgcccgcagcagcagcagcagc
agcagcaaccttcactccaggagccccagccggagtccagaagttaacccggatccaccg
tcgcccgccaacacaacacggccgccgtgcaacagcaaggagactgaccgcccctctgct
gcccattggcagttggataaatggctgaagaaatcccagaaaaaatcttccaggagtgaa
caggaatcctcccagagcattccaggacgccttccttctccccacacccaacgagcccca
tctccagcaaggtcctgggacagcaatcaggaatacagccccagccaaagccccattcct
agcccacagttccattacagcaacaacaacagccctttacccagccccggttatagctac
tgtcccagtcccagcccattccccagcacctgcccaagtcccagccctagcccgaggcac
agcctgatcctaagtccggttccaagtgtttgtcccagtccacgtgggagcccgggagcc
agccgtagccctagtcctatacctaggggccctccaagaagccccagtcccagcttacct
gctccttccagggtttgtcactaccctgaggttcagagtcagaaccaaacacaacctagc
ctaacaaccaatgcccacaggacaaaaaataggtcatggattgccccgccgcctaacacc
gataccaagtgcaagcctgcgaacagtactcaccttcagacgcctcatcaacaccggccc
aaggctcaactcacacagaaacaagaccaaagccaaagcaaacccaaggctcctgctgcg
ttaaactcaaatcagagcaacagccacaagtctagacccaagcctaacttccattcaggt
tctaaacagctctccgaggctcccaaagccaaacacgtgccacagtttgagcaaatccag
agtagcagatctaaccaaaactccaaccacaagctcaggccttcgtttcagtctagctca
caacacagtcccacaagggcaaagcacttagctcccacaagccgtgaacctaaccctggc
catagttcccattcccaatctccctctaaaagtgctgctaattctaatacagggttgaac
tctagatcaaaccctagcctaaaacctccaagggccaagtcttgcgaggctgcagcccca
actcctgtgcatgataaccatacaaaagcaacaccgaaaaaaccccagtacaaggagcaa
gaggtggaacacagaggagaacatctgacccaaacagacgggagaaaacaagagagaaaa
caggagagacagaaggacaaacaacaagggaagcaggagagaaagcaagacaggaggctg
gcggaggagcagctactgagacgtccctggatccagagttcagcagaagaagaggaggag
gaagaggaggaggaggagaaggaggaagaagtgatcgagaggcagaggaagagagaggag
acatcaagaggggaaaatagtcggaggagggagcagcaacatagacgcgaatggcaaacc
agaccaaaaccgagacaacgccttcaggacgagtcacaccagcaggggaggacaaaaaag
ttaggcaggagtgaggaagagaagcaagacccttcacctccttcaccacgctcctctact
cctcgcataccgtcctcctcgtcctctgcctcctcctcttcggattcagattcagaacct
gagtgtcgggctccgatcaccaaagttccagcagactctacctcccacaagagacccgat
ccgaagagaggcacgtctgacgccagcgggtcgaaggtggtgcaccccagaggatccact
tcgggcaatccgagcgaggggaagcaaaaactctacaccttggtcccgttcgggcgagct
gaaaaagctacggcacctgcccagcgggggcttagaaacctggtggtgcagatagacctc
tgtctcctcaaaagggtcccggacagcactactggccctgttgttaaaaaggccccctgt
tcctcctcttcttcatccaccaaggacaagcaaagagaggctatgaaacacctgtacgtc
ccagagactgcgacgaaagacggcaaaaggaaacgcaagttggagaatggtgtgtcacac
aaagagagcaagaggagtgttcctcacacgaatgacctctcaggccgcacagagtcttca
gctcacacggctgagcacagctttgtgactgagactacgcacaacgggtacttggaggag
tacttggacagcaagaggccgttgtcacccctctctccactgtccgtcagctccgagtcc
gccaagcctccctccaaaaccaagactgtagagcagccccatgtccacaagaacagagac
aagaaaagcgattctgctataaagcccaagatggaggtggaatgcgtaaaagtgtccaaa
cagccccacccaccatccgagtcctggggtcctgcagggcaccgggggactgtgccaaac
cacgaaactcctcaccatgccgagtactacttacatgaagcaaaaaggatgaagcaccgc
gctgatgcgatggtggacaagctcgggaaggctgtgaattacatggacgctgctctctcc
ttcatggaatgtgggaaagcgatggaggaagggccactagaggcaaagtctccttacacc
atgtactcagagacggtggagctcattaggtatgcaatgaggctgaagagccactccggc
cccggggcgagacaggaagacaaacagctggcggttctgtgtttccgatgccttgccctc
ctttactggcaaatgtttcgtttaaagaaggaccacgcactgaaatactccaaagttctg
ctggactacttcaagagttctcccaaagtgccttctacaccaccctgctggagcgactct
gggaagggagcaggaggacttccttcttcactctcacccaatgccaaacaccccagacag
ggttcacacgggggcagcaacaacttaccctctctcataagcattccccaacgcatccac
cagatggctgcaaatcacctgaacattaccaacagtgtcctgtacagctacgagtactgg
gaggtggcagacaacctcgcaaaggagaacaaagagttcttcaactacttgaatactttg
tctggacctttgactcttcacagtagcatcgctcacgcagtccaatacaccagacaggcc
cttcagtggatacgcatcagtgccaaacttaactaa

DBGET integrated database retrieval system