KEGG   Larimichthys crocea (large yellow croaker): 104929787Help
Entry
104929787         CDS       T04659                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-7 subunit
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04010  MAPK signaling pathway
lco04260  Cardiac muscle contraction
lco04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104929787
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104929787
   04261 Adrenergic signaling in cardiomyocytes
    104929787
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lco04040]
    104929787
Ion channels [BR:lco04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   104929787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716 SUR7 L_HMGIC_fpl DUF202
Motif
Other DBs
NCBI-GeneID: 104929787
NCBI-ProteinID: XP_019108988
Position
XIII
AA seq 341 aa AA seqDB search
MSSCSSRALTILSTVFGACGLLLVGVAVSTDYWLIMVEGIILQQNQSMEVKMALHSGLWR
VCFVAGSENGRCVASEYFTEPDIEITTENTANILKMVRTATPFPMVSLLFVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPREPEQFFNYHYGWSFA
FAASSFLLKEGAGVMSVYLFMKRYAEEEMYRPHPALYRPRLSDSSDYSGQFLHPESSWPP
PKRGRSTSEASSDISIQLNQAPPAPPKSKLQAASSQGSPPSGSSSAGSYQMPPQSAGYPS
HTLTRSHSSHPQGQALPMAMPPSPVPPPHYHTHMHMSASPC
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgtgcagcagccgtgcgttgaccatcctgtccacagtgtttggagcctgcggg
ctgctgctggtgggggtggccgtgtccacagactattggctgatcatggtggagggcatc
atcctacagcagaaccagagcatggaggtgaagatggcgctgcattcaggcctctggaga
gtttgcttcgtggctggatcagaaaacgggagatgtgttgcatcagagtacttcaccgaa
cccgatattgagatcaccactgaaaacactgcaaatatcctcaagatggtgcggacagcc
acgcccttcccgatggtgtcgctgctctttgtcttcacggccttcgtcatcagtaacatc
ggtcacatccggcctcagcgcaccatcctggcctttgtgtccggcatcttcttcatcctc
tcaggcctcagtctggtggtgggcctggtgctctacatctccagtattaatgatgaggtg
atgaaccgacccagggagcccgagcagttcttcaactaccactatggctggtcttttgcc
ttcgctgcctcttccttcttactcaaagagggggcgggggtgatgtcggtctatctgttt
atgaaacgctacgcagaggaagagatgtaccgcccccaccccgcactctaccgcccccgc
ttgtccgacagcagtgactacagtggccagttcctccacccagagtcctcctggcctcca
ccgaagagaggtcgcagcacctccgaagcctccagcgacatctccatccagctcaaccag
gcacccccagcaccacccaagagcaagctccaagcagccagcagccagggcagcccacct
tctgggtcttcttccgcagggagctaccaaatgcccccgcagtctgctggatacccctcg
cacaccctgaccaggtcgcactcctcacatccccaaggccaggctcttcccatggccatg
cctccatcacctgtacctccccctcactatcacacgcacatgcacatgagcgcctccccc
tgttag

DBGET integrated database retrieval system