KEGG   Larimichthys crocea (large yellow croaker): 104930200Help
Entry
104930200         CDS       T04659                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 4
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04020  Calcium signaling pathway
lco04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    104930200
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104930200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lco04030]
    104930200
G protein-coupled receptors [BR:lco04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    104930200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srsx 7TM_GPCR_Srx CBFB_NFYA
Motif
Other DBs
NCBI-GeneID: 104930200
NCBI-ProteinID: XP_027138281
Position
X
AA seq 357 aa AA seqDB search
MDNGSSGLLGDVNTSQAELTSCATVRSPACRIFLYAFLSVAIVCTVVGNFLVVLSIAYFK
QLQSPTNSFVMSLAVADCLVGLLVMPYSMIRTVEGCWYFGFLFCRLHSSLDVMLCTASIF
HLSCIAFDRYYAVCNPLLYSLKMPHSRVALLIVVCWAVPMLISFGPIMLDLHIAGVDVIL
PKDVCVFLVNRIYAVMASLVAFYLPMAIMLVAYWKIFKAAKRQARQISAMESQMAAGVGK
DSSKKQRHRNAMKRERKAAKTLGIIMGVFLIFWMPFFTVNIVDPFIEYSTEVFVWDIFLW
LGYINSSLNPFLYGFFNRSFRRAFLMFMGCRVCLPGSSPGMELSHTRKDANERADQP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggataacggcagctcgggattgctcggagatgttaacacatctcaggctgaacttaca
tcctgcgctacagtgaggagcccggcctgtcgcattttcctatatgccttcctctctgtt
gctatcgtctgcacagtggtgggaaacttcctggtggtcttgtccatcgcctacttcaag
cagttgcagtcacccacaaactctttcgtcatgtccctggcagtggctgactgcctggtt
ggcctgttagtcatgccttatagtatgattcgaactgtggagggatgttggtatttcggt
ttccttttttgtcggcttcactcaagcctcgatgtcatgctctgcactgcctccatattc
catctcagctgcattgcctttgaccgctactatgctgtctgcaacccactactttactct
ttaaagatgccccacagtcgggttgctctccttattgttgtatgttgggctgttcccatg
ctcatttcctttggccccataatgctcgatcttcatattgctggtgtggacgtcattctc
cctaaagatgtatgcgtgttcttggtcaatcgcatttatgctgtgatggcttctttagta
gccttttacttgccgatggctatcatgctagttgcctactggaaaatcttcaaggctgcc
aaaagacaggccaggcagattagcgccatggaaagccagatggctgctggcgtgggtaaa
gactcgagcaagaaacaaagacatcgaaacgccatgaagagggaaagaaaggcagcaaaa
actttgggtatcatcatgggagttttcctgatcttctggatgcctttctttacagtcaac
attgtggacccgttcattgaatacagcacagaggtgtttgtctgggacatatttttgtgg
ttgggatatatcaattcatctctaaatcccttcctgtatggtttctttaaccgttccttt
cgtagggcatttctcatgttcatgggctgcagggtgtgcctgcctggatcctcccctggg
atggagctatcgcatactcgcaaagacgcaaatgaacgtgcagaccaaccataa

DBGET integrated database retrieval system