KEGG   Larimichthys crocea (large yellow croaker): 104931681Help
Entry
104931681         CDS       T04659                                 

Gene name
idh1
Definition
(RefSeq) isocitrate dehydrogenase [NADP] cytoplasmic
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00020  Citrate cycle (TCA cycle)
lco00480  Glutathione metabolism
lco01100  Metabolic pathways
lco01200  Carbon metabolism
lco01210  2-Oxocarboxylic acid metabolism
lco01230  Biosynthesis of amino acids
lco04146  Peroxisome
Module
lco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lco_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104931681 (idh1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    104931681 (idh1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104931681 (idh1)
Enzymes [BR:lco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     104931681 (idh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh DDOST_48kD
Motif
Other DBs
NCBI-GeneID: 104931681
NCBI-ProteinID: XP_010745050
Position
XVIII
AA seq 414 aa AA seqDB search
MSQKIKAGSVVEMQGDEMTRVIWELIKEKLILPYLELDLHSYDLGMENRDATDDRVTVEA
AEAVRRYNVGIKCATITPDEKRVEEFKLKQMWRSPNGTIRNILGGTVFREAIICKNIPRL
VPGWIKPIIIGRHAHGDQYKATDFVVPGPGKVEMTYTPTKGEPVKFVIHEFEGTGGVAMG
MYNTDKSIRDFAHSSFQMALTKAWPLYLSTKNTILKKYDGRFKDIFQEIYEKEYRAQFEA
KGIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLICPDGR
TVESEAAHGTVTRHYRQHQQGKETSTNPIASIFAWTRGLLHRAKLDNNTELRVFSEALEA
VCIETIEAGFMTKDLAICIKGLPNVTRADYLNTFEFLDKLAENLKSKLANQPKL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagaagatcaaggcaggctctgtggtggagatgcagggagatgagatgacccga
gtcatctgggagctcattaaggagaaactcatcctcccgtacctggagctggacttgcac
agctatgacctcggtatggagaaccgagacgcaacagatgaccgggtgacagttgaggcg
gcggaggcagtccggcgttacaatgtgggcatcaaatgtgccaccatcacgccagacgag
aagcgggtggaggagtttaagcttaagcagatgtggcgttcgcccaacggcaccatccgt
aacattctaggaggcacggtgttcagggaggccatcatctgcaagaacatcccacgcctg
gtaccgggttggatcaagcccatcattattggcaggcacgcccatggagatcagtacaaa
gccacagacttcgtggtgcctgggcctgggaaagtggagatgacctacacgcccacaaaa
ggagagccagttaaatttgtcattcatgagtttgagggcacaggtggtgttgccatgggg
atgtacaatacagataagtccatcagggactttgcccacagctccttccagatggccctg
accaaagcctggcctctatacctcagcaccaagaacaccatcctgaagaagtacgatggt
cgcttcaaagacatcttccaggagatctacgagaaggaatatcgtgctcagtttgaggcc
aaaggtatctggtatgagcaccgtctcatcgacgacatggtggcccaggccatgaaatct
gagggaggcttcatctgggcctgcaagaactacgatggagatgtacagtctgactctgtg
gcacaaggctacggctccctgggtatgatgaccagtgtgctgatctgccctgatggacgc
acagttgagtctgaggccgcccatggcacagtgactcgccactacagacaacaccagcag
ggaaaagagacctccaccaatcccatcgcctccatctttgcatggacacgaggcctcctc
caccgggcaaagctggacaacaacacagagctgcgagtgttctctgaagccctggaggcc
gtgtgcatcgagaccattgaggctggattcatgaccaaggatttggctatttgcatcaaa
ggcctgccaaatgtgactcgtgctgactacttgaacacctttgagttcctggacaagctg
gcagagaacctgaagagtaagctagccaaccaacccaaactgtga

DBGET integrated database retrieval system