KEGG   Larimichthys crocea (large yellow croaker): 104931953Help
Entry
104931953         CDS       T04659                                 

Definition
(RefSeq) deoxyribonuclease-2-beta-like
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04142  Lysosome
Brite
KEGG Orthology (KO) [BR:lco00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    104931953
Enzymes [BR:lco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     104931953
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNase_II
Motif
Other DBs
NCBI-GeneID: 104931953
NCBI-ProteinID: XP_019114442
Position
XVII
AA seq 348 aa AA seqDB search
MEMAKCRIIMSLLLIVGILFQGCDSDVKCRNDNGRAVDWYMLYKLPAGLSYMYMDKSTRG
WELSREKINSRSGTLANTLKPLLDFYDNKSVNFGYMLYNDQPPNGMPSASYGHSKGVVML
DEQTGVWLSHSTPKFPTYRNRDFWPTSGNPNAQTFICVTYPYSEFKKIGLHLKYIHPYSY
DSAIPTTFHEELRCVAQQKCYPKLKPWSFVRKLTSVKGSHFFSFAKYTRFGDDLYSGLIV
KYLKRNLYVKSWGRMRHRLPSNCSTSIPHHVYNVKTINLNGKFFRDTVDHSKWCVTPGGV
WTCIADTNREVSQMRRGGGAICINDGKVQKAFSALISRYEHCKPASPP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggagatggcaaaatgtagaataataatgagcttgctcctcattgttgggatccttttt
caaggctgtgattcagatgtgaaatgtaggaatgacaatggaagagcagtggactggtat
atgttatacaagttgcctgctggcttgtcatatatgtacatggacaagagcaccagagga
tgggaactcagcagagagaaaatcaacagtagatctggcactctggcaaacaccctgaaa
cctcttcttgatttctacgacaataagagtgtcaactttggatacatgctctataatgac
caacctcccaatggtatgccctctgcatcgtatggtcacagtaaaggagtcgtgatgttg
gatgaacaaactggagtttggctctcacacagtacaccaaaatttccaacatatcgcaac
agagacttctggccaaccagtggaaacccaaatgctcagacatttatctgtgtgacttac
ccctatagtgaattcaaaaaaataggattgcatcttaagtatatccacccttattcatat
gactctgccatcccgacaacctttcatgaagagctgcgatgtgttgcacagcaaaaatgc
tacccaaagctgaaaccatggtcttttgtgagaaagctgacttcagtgaaaggaagtcat
ttcttcagctttgcaaaatacacacgttttggggatgatctctactctggccttattgtg
aagtatttgaagcggaatctgtatgttaagagctggggaaggatgcgacaccgtctgcct
tctaactgcagcaccagtatccctcatcatgtgtacaatgtgaagacaataaatctgaat
ggaaagttcttcagggatactgtagatcactcaaagtggtgtgtgacacctggtggtgtt
tggacctgcatagctgatacgaacagggaagtgagtcagatgagaagaggtggaggtgca
atatgcatcaatgatggtaaagttcagaaggctttctctgcattgatctcacgctatgaa
cattgtaaacctgcatctccaccttaa

DBGET integrated database retrieval system