KEGG   Larimichthys crocea (large yellow croaker): 104933803Help
Entry
104933803         CDS       T04659                                 

Definition
(RefSeq) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1-like
  KO
K01242  ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00760  Nicotinate and nicotinamide metabolism
lco01100  Metabolic pathways
lco04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    104933803
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    104933803
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:lco04090]
    104933803
   00536 Glycosaminoglycan binding proteins [BR:lco00536]
    104933803
Enzymes [BR:lco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     104933803
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     104933803
CD molecules [BR:lco04090]
 Proteins
  104933803
Glycosaminoglycan binding proteins [BR:lco00536]
 Hyaluronan
  Cell surface receptors
   104933803
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rib_hydrolayse DUF3932
Motif
Other DBs
NCBI-GeneID: 104933803
NCBI-ProteinID: XP_019130695
Position
XXIII
AA seq 270 aa AA seqDB search
MNLKVIIGVVAAVAAVTIIVGVTLGVVLNQPSWGFREEFMERCEEFTEGNKTGCEQILGV
FEQAYVGKPSCDVPLSAYDPLMTTVPFTHSCNKTMFWSETKDLVHEYTSRNKDCFTLENT
LLGHCLDGQTWCGKEGSDETFTSGCPGWEDCVNSPVRSFWNRASAGFADHACGVASVMLN
GSLEKPFDPTSVFAEFELKRLRAPIVTRLNVILVIGEKSNCNSPNIYVDLRNALDPNVEC
ICKEVQKSQIDKCSPVQNMGCAACLLKTID
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgaaagtgatcataggcgtagttgctgctgttgctgctgtaacgattattgtt
ggagttacactgggagtggtgctgaatcaaccatcatgggggttcagagaagaattcatg
gaaagatgtgaggagttcacggaaggaaacaaaaccggctgtgaacaaatactgggtgtc
tttgaacaagcctacgtagggaagccaagctgtgatgttcctctgtcagcctatgacccc
ttgatgacaacggtccccttcacccattcatgcaacaaaacaatgttttggagtgaaacc
aaagatctggtccacgagtacacaagtaggaataaggattgtttcaccctggaaaacact
ctgttgggacattgcctggatggacagacatggtgtggaaaggaaggcagcgatgaaacc
ttcacttctggctgccctgggtgggaagactgtgtgaacagccctgttaggtcattttgg
aacagagcttctgctggatttgcagatcatgcctgtggagtagcctcagtaatgctgaat
ggatcactggaaaaaccattcgatcccaccagtgtatttgcagagtttgagctaaagaga
ctcagagcccctatagtgacgcgtctgaatgtgattctggtcattggagagaagtcaaat
tgtaacagtccaaatatatacgtggacttaaggaatgcactggatccaaatgttgaatgt
atttgcaaggaagtacaaaaatctcagatcgacaagtgctcccctgttcaaaatatgggc
tgtgcagcatgtttgttgaagacgattgactaa

DBGET integrated database retrieval system