KEGG   Larimichthys crocea (large yellow croaker): 104935111Help
Entry
104935111         CDS       T04659                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco03040  Spliceosome
lco04010  MAPK signaling pathway
lco04141  Protein processing in endoplasmic reticulum
lco04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:lco00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    104935111
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104935111
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104935111
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104935111
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lco01009]
    104935111
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lco03041]
    104935111
   03009 Ribosome biogenesis [BR:lco03009]
    104935111
   03110 Chaperones and folding catalysts [BR:lco03110]
    104935111
   04131 Membrane trafficking [BR:lco04131]
    104935111
   03051 Proteasome [BR:lco03051]
    104935111
   03029 Mitochondrial biogenesis [BR:lco03029]
    104935111
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lco04147]
    104935111
Protein phosphatases and associated proteins [BR:lco01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     104935111
Spliceosome [BR:lco03041]
 Complex B
  Other components
   Prp19 complex
    104935111
 Complex C
   Prp19-CDC5 complex
    104935111
Ribosome biogenesis [BR:lco03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    104935111
Chaperones and folding catalysts [BR:lco03110]
 Heat shock proteins
  HSP70 / DNAK
   104935111
Membrane trafficking [BR:lco04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    104935111
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    104935111
Proteasome [BR:lco03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    104935111
Mitochondrial biogenesis [BR:lco03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    104935111
Exosome [BR:lco04147]
 Exosomal proteins
  Proteins found in most exosomes
   104935111
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR
Motif
Other DBs
NCBI-GeneID: 104935111
NCBI-ProteinID: XP_027129166
Position
XXII
AA seq 650 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFEDSVVQSDMKHWPFNVISDSGRPKVEVEYKGETKSFYPEEIS
SMVLIKMKEIAEAYLGKSVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA
IAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRA
RFEELNADLFRGTLDPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKN
GLESYAFNMKSTVEDDKLAGKLSDEDKQKILEKCNEVISWLDKNQTAERDEYEHQQQELE
KVCNPIITNLYQSAGGMPGGMPGGMPGGFPGAGGAPSGGGSSGPTIEEVD
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagggaccagcagtcggtatcgacctcgggaccacctactcctgtgttggtgtg
ttccagcatggcaaagttgaaatcatcgccaacgaccagggcaacaggaccacacccagc
tacgtggccttcacagacagcgagaggctgatcggagatgcagccaagaatcaggttgcc
atgaaccctaccaacacagtctttgatgctaaacgtttgattggcagacgatttgaggat
tctgtagttcagtctgacatgaagcactggccatttaatgtaatcagtgatagtggacgg
cccaaagtggaggttgaatacaaaggtgaaaccaaaagcttctacccagaagagatctcc
tccatggtgctgataaagatgaaagagattgctgaagcctaccttgggaagtctgtgtcg
aatgctgttatcacagtacctgcatactttaatgattctcaacgtcaagcaaccaaggat
gctggaaccatctctggcctcaacgttctgcgtatcatcaatgagccaaccgctgctgct
attgcttatgggttggacaagaaggttgggtctgaaaggaacgttctcatctttgatctc
ggtggaggcaccttcgacgtgtccatcttgaccatcgaggatggtatctttgaggtcaag
tccacagctggagatactcatcttggtggtgaggacttcgacaaccgcatggtcaaccac
ttcattgcagagttcaagcgcaaatacaagaaggacatcagcgacaacaagagagccgtc
cgtcgtctgcgcacagcctgtgagagggcgaagcgtaccctgtcttccagcacccaggcc
agcattgaaatcgactctctgtacgagggagttgacttctacacctcaatcaccagggct
cgcttcgaggagctcaacgctgacctcttccgtggcacattggaccccgtggagaagtcg
ctccgtgacgccaagatggacaaggcccagatccatgacatcgtgttggtcggtggctcc
acccgtatccccaagatccagaagctgcttcaagatttcttcaatggaaaggagctcaac
aagagcatcaatccagatgaagccgtggcctatggagctgccgtccaggcagccatcctg
tctggtgacaagtctgagaatgtgcaggacctgctgcttctcgacgtcacccctctgtcc
ctgggtatcgagaccgctggaggtgtcatgaccgtcctgatcaaacgtaacaccaccatt
cccaccaagcagacccagaccttcaccacctactccgacaaccagcctggtgtgctcatc
caggtctacgagggtgagcgtgccatgaccagagacaacaacctgctgggcaagtttgag
ctgacgggcatccctcctgctcctcgtggtgttccccagatcgaggtgacattcgatatt
gacgccaacggcatcatgaatgtttccgctgtcgacaagagcaccggcaaggagaacaag
atcaccatcaccaacgacaaaggtcgtctcagcaaggaggacattgaacgcatggtccag
gaagccgagaagtacaaggctgaagatgacgtccagcgtgacaaggtgtctgctaagaac
ggcctggagtcgtatgctttcaacatgaagtcgactgtggaggatgacaagcttgctggc
aagctcagtgacgaggacaagcagaagattttggaaaagtgcaacgaggtcatcagctgg
ctggacaagaaccagacggcagagagggacgaatatgaacaccagcaacaggagctggag
aaggtgtgcaaccccatcatcaccaatctgtaccagagcgctggcggcatgcccggcggg
atgcccggcgggatgccaggcggcttccctggagccggcggtgctccttccggtggagga
tcctctggaccgaccatcgaggaagttgattaa

DBGET integrated database retrieval system