KEGG   Larimichthys crocea (large yellow croaker): 104935254Help
Entry
104935254         CDS       T04659                                 

Definition
(RefSeq) cytosolic phospholipase A2
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00564  Glycerophospholipid metabolism
lco00565  Ether lipid metabolism
lco00590  Arachidonic acid metabolism
lco00591  Linoleic acid metabolism
lco00592  alpha-Linolenic acid metabolism
lco01100  Metabolic pathways
lco04010  MAPK signaling pathway
lco04217  Necroptosis
lco04270  Vascular smooth muscle contraction
lco04370  VEGF signaling pathway
lco04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    104935254
   00565 Ether lipid metabolism
    104935254
   00590 Arachidonic acid metabolism
    104935254
   00591 Linoleic acid metabolism
    104935254
   00592 alpha-Linolenic acid metabolism
    104935254
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104935254
   04370 VEGF signaling pathway
    104935254
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104935254
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    104935254
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104935254
Enzymes [BR:lco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     104935254
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 104935254
NCBI-ProteinID: XP_027140730
Position
XII
AA seq 536 aa AA seqDB search
MSAVTPQIEGISREERTPTSLPNLDRESAFTVKSQSLSAEEQEFVLKRKQVVLKSLNSLG
IECTMESVPHIAVLGSGGGQRAAVGLLGSLYQMEKEGLLDTLLYLGGVSASAWSMSTLYS
DPEWSSNMDRAVSRLSGPSVMLEQALTWLDKRAKDEHFSLTDIWGVLTSAGIMKQVCFKH
ADCLCLSVFGTAKWFEITPHEAGFTDLGLFINTSHLGSRIHEAEPDGKGPEMDMVKLQGI
VGSAIADEGSLVNSIPDWLKDLVGVAAADENNLLDRMFLRTEVPHQVNSFLDFLDSYMRM
NNGLLKLTELIKKNTEDPAVWSGVDNLQKTLRASSLIQKVFPLIWKWEWRTTENFLYNYS
SAVVPPCVSHKEHLQLIDAGLMLNLPYPPFLGGKRDADLLIALDYGSDEAFKTLTNARDY
AAAVKKPFPEIDNKILEERDWPKDCYVFEGKEKEPTIVYMPLFNRHNCKDAQKVKEKMEE
FYTFQLPFSQDKIELVLETAKANVKNNKETLLREIYKAALRRHKRYYSTSSTKHGL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcagtcactcctcagatcgaaggtatatcaagggaagagaggacaccgacttct
ctacccaatctagacagagagtcagcgttcactgtcaagtcccagtcattgtctgcagag
gagcaggagtttgtcctcaagaggaaacaagtcgtactgaagtcactcaacagcctggga
atcgagtgtacaatggagtcagttcctcacattgcagtcttagggtcaggtgggggtcaa
agagcagccgtgggtctgctgggttccctctatcagatggaaaaggaaggtctgctggac
actctgctctacctgggaggagtttctgcctctgcctggtccatgtccacactgtacagc
gacccagagtggagctccaacatggacagagcggtgtccaggctgtcaggtcctagtgtt
atgctggaacaggctctgacctggttggacaagagggcaaaggatgagcacttctctctt
actgatatctggggggtcttaacctctgctgggatcatgaaacaggtatgtttcaaacac
gcagattgtctctgtctctctgtctttggcacagctaaatggtttgagattactcctcac
gaggctggcttcacagatctgggtctcttcattaacacctctcatcttggtagcagaatt
catgaagcagagcctgatggtaaagggccagagatggacatggtcaagctgcaaggtata
gttggcagcgccatcgcagatgaaggcagtttggtgaattccattcctgactggctaaaa
gatctggtgggtgtagcagctgctgatgaaaacaacttactggataggatgtttctccgg
actgaagttccacatcaggtcaacagtttcttagatttcttggacagttacatgcgcatg
aacaacggccttttgaaactaacagagctgatcaaaaagaacacagaggatcctgctgtt
tggtctggagtggacaacctgcagaaaacactgagagcctcttcattgatccagaaagtc
ttcccactcatttggaaatgggaatggagaacaactgaaaacttcctctacaattattcc
agtgctgtggtgccaccttgtgtcagtcataaggagcacctgcagctgatagacgctggt
ttgatgctgaacctgccctacccgcccttccttggaggaaagagagacgcagacctgctc
attgctctggactatggatctgatgaagccttcaagaccctgactaatgccagagactat
gcagccgctgtaaagaagcctttcccagagatagacaacaaaatcctggaggagagagac
tggccaaaggactgctatgtgtttgagggaaaagagaaggagcccacgattgtttacatg
ccgctcttcaacagacacaactgcaaagacgcacagaaggtcaaagaaaagatggaggag
ttctacaccttccagcttccgttcagccaggataagattgagcttgtgttggagacggcc
aaagccaatgtgaagaacaacaaggaaactctgctgagggagatttacaaggctgctctc
cgccgacacaagaggtattacagcacgtcatcaacaaagcatggtctctaa

DBGET integrated database retrieval system