KEGG   Larimichthys crocea (large yellow croaker): 104936552Help
Entry
104936552         CDS       T04659                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X2
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00010  Glycolysis / Gluconeogenesis
lco00562  Inositol phosphate metabolism
lco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104936552
   00562 Inositol phosphate metabolism
    104936552
Enzymes [BR:lco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     104936552
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     104936552
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF2536 PHZA_PHZB
Motif
Other DBs
NCBI-GeneID: 104936552
NCBI-ProteinID: XP_010750908
UniProt: A0A0F8B9P6
Position
Unknown
AA seq 469 aa AA seqDB search
MFSVLPPTNTLVLAALCLVLTRLSCSSVSVPDIPHIAAYFGTKTRYEEVNPHLLRDVFSV
NSSILKPPPNERCTPVHLTAIIRHGSRYPTVKNIRRIHKLSELVRREAPPGGASSAGSAA
WLQDIQNRWENWYTEDMDGQLVMKGREDLRQLAVRLSSLFPSLLSEENMRRISLRSSSKH
RCVSSVEAFQDGLQQVWSRQDVQYSHQVDDELMRFFERCRGYVEGVENNRTALLEVEKFK
HGMEMEAVRRRMAERLGLPHHRLTPDLVEAAFFLCSYELSIKSLYSPWCFLFDENDAKVL
EYKSDLKQFWKRSHGHVISSLSSCPLFHHVFRTLDKAGRPRRSTEASPEPASILVGHAET
LLPLLSLLGLYKDQTSPTADNYHSQHSRSFRTSLIVPYAANLLFVLYDCQRGPRLQMLIN
ESPVRFPGLMEDAPLYRDVRATYRHLLDGCDFHRECEGRPGGRGPNTEL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgttctccgttttaccgcccacaaacactttagtgttggcggctctgtgtctggttctg
acccgcctctcctgctcctctgtgtcggtcccggacatcccgcacatcgccgcttacttc
ggaaccaagacccgatacgaggaggtgaacccgcacctgctgcgggacgtcttctccgtc
aacagctccatcctaaaacctccgcccaatgagcgctgcaccccggtccatctgaccgcc
atcatcaggcacggcagccggtacccgaccgtcaaaaacatccggaggatccacaagctg
agcgagctagtccggagagaagctcccccaggaggcgcgtcctccgcgggctccgcggcc
tggctgcaggacatccagaaccgatgggagaactggtacaccgaggacatggacggtcag
ctggtgatgaaggggagagaagatcttcgtcagctggccgtccgtctctcctcgttgttc
ccgtcgctcctctcagaggagaacatgaggaggatcagtttgaggagcagctcaaagcat
cgctgtgtgagcagcgtggaggcgtttcaagacggcctgcagcaggtgtggagccgccaa
gacgtgcagtacagccaccaggtggacgacgagctcatgcgcttcttcgagcgttgccgt
ggttacgtggagggcgttgagaacaaccgcacagcactgctggaggtggagaagttcaaa
cacggcatggagatggaggcagtgaggaggaggatggccgagaggctgggcctgcctcac
caccgcctcaccccagatttggttgaagcagcgttcttcttgtgttcatacgaactgtca
atcaaatctctttactcgccatggtgtttcctgtttgacgagaatgacgcaaaggtgctg
gagtacaagtcggacctgaagcagttctggaagcggtctcatggtcatgtgatcagcagt
ctgtccagctgtcctctctttcatcacgtcttcaggacactggacaaagcaggacgtcca
cgcaggtccacggaggcgtcgcctgagccagcctccatcctggttggtcacgccgagacg
ctcctccccctcctctccctgcttggactctacaaggaccagacttcgcccactgcagac
aactaccactcacagcacagtcgaagtttccggaccagtctgatcgtcccatacgccgcc
aacctgctctttgtcctgtacgactgccagcgaggcccacggctgcagatgctcatcaac
gagtcaccagttcgattcccagggctgatggaggacgcgccactgtacagagatgtccgg
gccacgtaccgccacctgctggacggctgtgacttccaccgcgagtgtgagggaagacct
ggaggacgaggaccgaacacagaactctga

DBGET integrated database retrieval system