KEGG   Larimichthys crocea (large yellow croaker): 104937382Help
Entry
104937382         CDS       T04659                                 

Definition
(RefSeq) cAMP-responsive element modulator isoform X1
  KO
K09052  cAMP response element modulator
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:lco00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104937382
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lco03000]
    104937382
Transcription factors [BR:lco03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    104937382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf TMCO5 Rh5
Motif
Other DBs
NCBI-GeneID: 104937382
NCBI-ProteinID: XP_010751904
Position
II
AA seq 315 aa AA seqDB search
MDTSASPQMDDSLNDSLTDGEEDHSEGSPSPQVSVAEAESPGVTVVTMSDGQMLQVQGVI
QAPQTSVIQSVQIATVAELDDDAPVTDTQKRREILSRRPSYRKILNELSTDSPAVPKIDE
EKTEEEAAAAAASVASASAPTSIYQTSSGQYIAFTQGRAIQLTGSGAEALQGSQTLAVAS
SPTPQPGATILQCAGQPGDSSQQYFIQGGQVLIQAATGDIPAYQLRSPNSGLAQSIVMAA
SPGTMQSPSSQHAEEITRKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLI
EELKALKDIYCHKAE
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggatacgtctgcctcgcctcagatggacgacagtttaaatgactcgctgacagatgga
gaggaggaccacagtgaaggcagtccatctcctcaggtgtcggtggcagaagcagagtct
cccggtgtgactgtcgtcactatgtctgacggtcaaatgctgcaggtccaaggggtcatc
caggcccctcagacctctgtcatacagagtgtccagattgccactgtggcggagctggac
gacgacgctcccgtcacagacacccagaagaggcgggagattctctccaggcgtccatct
tatcgaaaaatactcaacgagctttcaacggattcaccggcagttcctaaaatcgatgaa
gagaagacggaggaggaggcggcggcggcggcggccagtgtggcctcggcatcagcgccg
acctccatctaccagaccagctcaggacaatacattgcgttcactcaggggagagccatc
cagttgaccggctccggagctgaagcccttcagggctcacagaccctggcggtggccagc
tctcccaccccgcagcctggagctacaatcctacagtgtgcggggcaacccggagactct
tcacagcaatacttcatccagggaggacaggtgctcatccaagctgccacaggagacata
cccgcctaccagctgcgttcgcccaactcgggcctggcccagagcatcgtgatggcggcg
tccccgggcaccatgcagagcccgtcgtcgcagcacgcggaagagatcacccgcaagagg
gaggtccgactgatgaaaaacagggaagcagctcgcgagtgccgcaggaaaaagaaagag
tacgtcaaatgtctggaaaaccgcgtggccgtgttggaaaaccaaaacaagaccctgatt
gaagagctgaaagcactgaaggacatttactgccacaaagcggagtag

DBGET integrated database retrieval system