KEGG   Larimichthys crocea (large yellow croaker): 104938224Help
Entry
104938224         CDS       T04659                                 

Definition
(RefSeq) cis-aconitate decarboxylase
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    104938224
Enzymes [BR:lco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     104938224
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-GeneID: 104938224
NCBI-ProteinID: XP_010752890
Position
I
AA seq 495 aa AA seqDB search
MISTLQRTIRPVWASRGLHNSAVEALKYQAPGDTVTASYGKFISEIKPQHLSSVVLHRSK
RMVLDSIGVGMIGSTTDVFELALQHCQHMYAPDDISSIYGRTGTRLSPTLAAFVNGVATH
SMDFDDTWHPATHPSGAVLPAVLALSDMMPASNKPSGLDFLLAFNVGIEIQGRLMRFSNE
AHNIPKRFHPPSVVGTMGSAAACARLLSLDHSKCSHALAIAASLSGAPMANAATQSKPLH
IGNASRLGLEAALLASRGLEASPLVLDAVAGVAGFNAFYEDYVPQPLESPNKNGHMFLLE
EQDIGFKRFPAHLGMHWVADAAASVHKLLVGFGPGTVSPAQVKDILLRVPKSKYINRPFP
DSEHEARHSFQFNACSALLDGEVTVQSFTPAAMMRPDLFALLSRVRVEHPQDNPANFNLM
YGEVQVTLVGGDILKGRCDTFYGHWRNPLTNESLKKKFRNNAGAVLPSEKVEKLIDVVEE
LDRLGDCRDLLSELQ
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgatctccacattacagagaaccattagaccagtctgggctagcagagggctgcataac
tctgcagtggaagccttaaagtaccaggcacctggggacacagtcacggccagctatggg
aagttcatcagtgagataaagccccagcacttgtcctcagtggtgcttcaccgcagtaaa
agaatggtgctggacagcattggagttggtatgattggcagcacaacagacgtgtttgaa
ctggcccttcagcactgccagcacatgtatgctcctgatgacatcagctctatctatgga
cgcacaggcacaaggctctccccgacactggcagctttcgtcaatggagtggccactcac
tccatggactttgatgatacatggcaccctgccactcatccctcaggagcagtccttcct
gctgtgttagcactcagtgacatgatgcctgctagtaataaacccagtggcctggacttc
ctgctggcattcaacgttgggattgagatccagggccgattaatgaggttctctaatgag
gcccacaacatccctaagaggtttcaccctcccagtgtggtgggcaccatgggaagtgca
gctgcctgtgctcgcctcttgtctttggaccactccaagtgcagtcatgccttggctata
gctgcttctctatctggggccccaatggctaatgctgccactcagtctaaacccctccac
attggtaatgcctcacgtctggggcttgaggctgctctgctggcctcccgaggcctagaa
gcgagtcctctggtcctggatgctgttgctggggtggctggcttcaatgcattttatgaa
gactatgtaccacagcctttagaatcacccaataagaacggccatatgttcctgctagag
gagcaggacataggctttaaacgcttccctgcccatctggggatgcactgggtggcagat
gctgcagcctcagtccataagcttcttgttgggtttggccctggcactgtctctccagct
caagtcaaagacatcctgctcagagtccccaaatcaaagtacataaacaggcctttcccc
gactctgagcatgaggcacgccactccttccagttcaatgcttgcagtgctctcctggat
ggcgaggtgactgtgcagtccttcacacccgctgccatgatgcgccctgaccttttcgct
ctgctgagccgtgtgcgtgtggagcatcctcaggacaacccagctaatttcaacctcatg
tatggagaagtccaggtgacacttgttgggggagacattctgaagggacgctgtgacacc
ttctatggtcactggcgcaacccactgaccaatgagagcctgaagaagaagttcaggaac
aacgcgggggcggtgcttccctcagagaaggttgagaagctgatcgatgtggtggaggag
ctggacagactcggggactgcagggaccttctctccgagctgcaatga

DBGET integrated database retrieval system