KEGG   Larimichthys crocea (large yellow croaker): 104939903Help
Entry
104939903         CDS       T04659                                 

Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00510  N-Glycan biosynthesis
lco01100  Metabolic pathways
Module
lco_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    104939903
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lco01003]
    104939903
Enzymes [BR:lco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     104939903
Glycosyltransferases [BR:lco01003]
 Glycan extension
  N-Glycan
   104939903
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 104939903
NCBI-ProteinID: XP_010754744
Position
XI
AA seq 420 aa AA seqDB search
MRFRLLKKNLLALLGVSFVVVTLLFSTRVLLLSDNDTSGHNNDNNIISVRGHSGEMVKFN
FGSLPELTQSVYSANYKQCVHNANKFPGEPQLVLVVQVHNRPEYLRLLIKSLEKAAEVHS
FLLIFSHDYFSEEINAIVQGITFCKVLQIYFPFSSQLYPSEFPGQDPRDCPRDISKADAL
KTGCLNAEHPDSYGHYREAFITQTKHHWWWKLHFVWERVQAMQGYSGFVIFLEEDNYILP
DFFHFYKSMIEFRKSSCPDCDMLALGNHDSLSDFTRLSNKVLTTGWMSTKHNIGMAISRE
VYYKLMGCNNEFCTYDDYNWDWTLQHLSGACISKPIKVLVAQGSRVLHTGDCGLHQKEKC
RPEWALQRVEDSLQAAKDGLFPASLALSGAEPVEHKAHMKNGGWGDVRDHILCKNYAKRL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaggtttcggctgctcaagaagaacctgctagctctgttgggtgtttcctttgtggtt
gtgactcttctcttttcaacacgtgtgttattattgtctgataatgacacaagtggacat
aataatgataataatatcatttcggtacgtggacattctggtgaaatggtgaagttcaac
tttggttcactgccagaattgactcagtctgtttacagtgccaattacaaacagtgtgtg
cacaatgcgaacaagtttccaggcgagcctcaactggtgctggttgtgcaggtccacaac
aggcctgaatacctcagactgctcatcaagtcgctggagaaagctgcagaggtccacagc
ttcctccttatctttagccatgactatttttcagaggaaataaacgccattgtgcaaggg
ataactttctgcaaagtgctacaaatttatttccccttcagctctcagctgtatcccagt
gagtttcctggacaggatccacgagactgccctcgagacatatccaaggccgacgctctg
aaaacaggatgcctcaacgcagaacaccctgactcctatggacactacagggaagccttc
atcactcaaaccaaacaccactggtggtggaagctgcactttgtctgggagcgagtgcag
gcgatgcagggctacagcggctttgtaatctttctggaggaggacaactacatcttacct
gactttttccatttctataaatcgatgatagagttcaggaagagcagctgcccagattgt
gacatgctggctttgggtaaccatgacagcctgagtgattttaccagactgtccaataag
gtgttgaccactgggtggatgtccactaaacacaacataggcatggctatctccagggag
gtgtattacaaactgatgggctgcaacaacgaattctgcacctatgacgactacaactgg
gactggactctgcagcacctctctggagcctgcatatcaaagcccatcaaagtgctcgtg
gcacagggctccagggttctccacacaggggactgtggtcttcaccagaaggagaaatgc
aggccagaatgggccttacagagggtcgaggacagtcttcaagcagcaaaggacggccta
tttcctgcatctcttgctcttagtggtgctgaaccagtggagcacaaggcacacatgaag
aatggaggatggggagatgtccgagaccatattctatgcaagaactatgccaaacgtctt
tga

DBGET integrated database retrieval system