KEGG   Larimichthys crocea (large yellow croaker): 104940345Help
Entry
104940345         CDS       T04659                                 

Gene name
abhd6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
lco  Larimichthys crocea (large yellow croaker)
Brite
KEGG Orthology (KO) [BR:lco00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lco01002]
    104940345 (abhd6)
Enzymes [BR:lco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     104940345 (abhd6)
Peptidases [BR:lco01002]
 Serine Peptidases
  Family S33
   104940345 (abhd6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Thioesterase DUF1057 Abhydrolase_3 Lipase Ndr UPF0227 SPT_ssu-like
Motif
Other DBs
NCBI-GeneID: 104940345
NCBI-ProteinID: XP_010755235
UniProt: A0A0F8D1Q5
Position
Un
AA seq 333 aa AA seqDB search
MELIIISGGIVVIPILTFITSVLFWPGALIKAYNWFTRHKLGLVVRYSHSGSYRFCYSTR
GTPGGTTPSLLLLHGFSANKDMWLPVIKYLPRNQHLVCVDMPGHEGTSRTGAEDYSIEGQ
VARIHQFVQSIGLDKRPFHVIGTSMGGNVAGVYAARYAAYLSGATLICPAGLVYPKDSEF
ISRLKKLENSPQEESIPLIPTTLQELEDMLSLCLCNSLSFPRPVLRGLLANRLPNNGFYK
EVFMEIAGEKSRHSLQENLHLITSPVQVIWGQEDQVVDVSGSTVLQAALPNCQVELLDNC
GHSVVLERPRKAAQLIVDFLSVQTGNGENKKLS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggagctgataataatatcagggggtattgtggtcatccccatcctcacattcatcacc
tccgtcctgttctggcctggagcgctcatcaaggcgtacaactggttcacacgtcacaag
ctgggactggtggtccgctactctcacagtggaagttaccgcttctgttattccacccgg
gggacaccagggggcactacgccatcacttctactactgcatggcttctctgcgaataag
gacatgtggctacctgtcatcaagtacctccccagaaaccagcatctggtgtgtgtggac
atgccggggcacgaggggacgagtcgcaccggggcagaggactacagcatcgagggccag
gttgcccgaatccaccagtttgtgcagagtatcggtctggataaaagacccttccacgtg
attgggacatcgatgggtggcaatgttgcaggggtgtacgctgcccgctacgctgcctac
ctgtctggagccaccttgatttgcccggcaggtcttgtttatcctaaagactctgagttc
attagtcgtctgaagaagctggagaacagtccacaggaggagtcaatccctctgatcccc
accacccttcaggagctggaggacatgctgagtctctgcctctgcaactcgctcagcttc
ccccggccggtcctacggggtctcctcgctaacaggttgcccaacaatggattttacaaa
gaagtgttcatggagattgctggagagaagtctcgtcactcactgcaggaaaacctgcat
ctgatcacatcacctgtgcaggtcatctgggggcaggaagaccaggtggtggacgtgtcg
gggtctacggtgctgcaggcggcactgccaaactgtcaggtggagctgttggacaactgt
ggtcactctgtggtgctggagcgacccagaaaggctgcacagctgatcgtggacttcctg
tctgtgcagacaggcaacggtgaaaataagaaactttcctga

DBGET integrated database retrieval system