KEGG   Lysobacter capsici: LC55x_0366Help
Entry
LC55x_0366        CDS       T04162                                 

Definition
(GenBank) RNA pseudouridylate synthase family protein
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
lcp  Lysobacter capsici
Brite
KEGG Orthology (KO) [BR:lcp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lcp03016]
    LC55x_0366
Enzymes [BR:lcp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     LC55x_0366
Transfer RNA biogenesis [BR:lcp03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    LC55x_0366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ALN83671
UniProt: A0A0S2FJD1
Position
399971..400771
Genome map
AA seq 266 aa AA seqDB search
MTVDPSFRTHGRMNHELTSADGAFDGDDESVAVPAELPVLYIDEVLAVIDKPAGLMVHDS
ALARGETDFAADRLRAQFGRPIFLVHRLDRATSGCLLLAFDRQTASDLGKVLMSREVEKD
YLAVCRGWPAQDVFEVDHDLDGGPGKPLKKPAQTRFAVLGRAELALPSSGFETSRYALLR
AQPLTGRFRQIRRHLKHLSHHLIGDTSHGDGRHNRSFRMMGIHRMLLHAQRLAFLHPRSG
ERMQVVAPVDAQFAKALALFEPPAAA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgatccttcgtttcggacccacggccgcatgaaccacgaactgacctcggcc
gacggcgcattcgacggcgacgacgaatccgtcgccgtcccggccgaactgccggtgctg
tacatcgacgaggttctggcggttatcgacaagccggcggggctgatggttcacgacagc
gcgctggcgcgtggcgaaaccgacttcgccgccgaccgcctgcgcgcccagttcggccgg
ccgatcttcctggtccatcggctcgaccgcgccaccagcggttgcctgctgctggcgttc
gatcggcagaccgcctcggacctgggcaaggtgctgatgtcgcgcgaggtcgagaaggat
tacctcgcggtgtgccgcggctggccggcgcaggacgtgttcgaggtcgatcacgatctc
gacggcggcccgggcaaaccgctcaagaagccggcgcagacgcgtttcgcggtgctgggc
cgggccgagctggcgctgccgtcgtcggggttcgagacctcgcgctacgccttgctgcgc
gcgcagccgctgaccggacggttccgccagatccgtcgccatctcaagcatctgtcgcat
cacctgatcggcgacaccagccacggcgacggtcgccacaaccgcagtttccgcatgatg
ggcatccaccgcatgctgctgcacgcgcagcggctggcgttcctgcatccgcgcagcggc
gagcggatgcaggtggtcgcgccggtggatgcgcagttcgccaaggcgctggccttgttc
gaaccgcctgcggcggcgtga

DBGET integrated database retrieval system