KEGG   Lysobacter capsici: LC55x_1547Help
Entry
LC55x_1547        CDS       T04162                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
lcp  Lysobacter capsici
Pathway
lcp00520  Amino sugar and nucleotide sugar metabolism
lcp01100  Metabolic pathways
lcp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lcp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LC55x_1547 (nagA)
Enzymes [BR:lcp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     LC55x_1547 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ALN84838
UniProt: A0A0S2FMF8
Position
complement(1741422..1742528)
Genome map
AA seq 368 aa AA seqDB search
MTELRNLQGRILTSEGWRRGRIRFDQKIRAVEEVAGGDIGETIILPGFIDLHVHGAAGVD
LMQGGDAARTVARAHVRHGTTALLGTTMTAAEPDIVHALRGLAAAIAEPDPDAARVLGVH
LEGPFISPQRLGAQPPLTVEATLESVQRLHALAPIKVLTLAPEIGSHNELIPQLSAMGIR
VQLGHSAGSYEDGVAALRAGAAGFTHLFNGMTGVDHYKPGIAAAALAHAEYAELIPDLQH
VHPGAIRLALRAIPRLYAVTDATAATGMPDGEYALGSQRVHKCLGCVRLASGSLAGSALT
MDQALRNLVEVGLDLADAAHRVSTFPADYLGLSDRGRLEPGACADFVVLDPQLRIVEVHV
AGRAVAFS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaactgcgcaatctgcaaggccggatcctcacgtccgagggctggcgccgcggc
cgcatccgcttcgaccagaaaatccgcgccgtcgaagaagtcgccggcggcgacatcggc
gagaccatcatcctgcccggcttcatcgacctgcatgtgcacggcgccgccggcgtcgac
ctgatgcagggcggcgacgccgcgcgcaccgtcgcgcgcgcgcacgtccgccacggcacc
accgccctgctcggcaccaccatgaccgcggccgagcccgatatcgtccacgcgctgcgc
ggcctcgctgccgccatcgccgaacccgatccggatgcggcgcgcgtgctcggcgtgcat
ctggaaggccccttcatcagcccgcaacgtctcggcgcgcagccgccgctgacagtggaa
gccaccctggaatcggtgcaacgcctgcacgcgctggcgccgatcaaggtgctgacgctg
gcgccggagatcggctcacacaacgagttgatcccgcagctgagcgcgatgggcatccgc
gtccagctcggccacagcgccggcagctacgaggatggcgtcgccgcgctgcgcgccggc
gcggccggcttcactcatctgttcaacggcatgaccggggtcgaccactacaagcccggc
atcgccgcggccgcgctggcgcatgccgagtacgccgaactgatccccgacctgcagcat
gtgcatcccggcgcgatccgcctcgcgctgcgcgcgattccgcgcctgtacgccgtcacc
gacgccaccgccgcgaccggcatgcccgatggcgaatacgcgctgggttcgcagcgcgtg
cacaaatgcctgggctgcgtgcgcctggccagcggttcgctcgccggcagcgcgctgacc
atggatcaggcgctacgcaatctggtcgaggtcggcctggacctcgccgatgccgcgcat
cgcgtctccaccttccccgccgactacctgggcctgtccgatcgcggccgccttgaaccc
ggcgcctgcgccgacttcgtggtgctggacccgcagttgcgcatcgtcgaagtgcatgtc
gccggccgcgccgtcgctttttcctga

DBGET integrated database retrieval system