KEGG   Lysobacter capsici: LC55x_3194Help
Entry
LC55x_3194        CDS       T04162                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lcp  Lysobacter capsici
Pathway
lcp00071  Fatty acid degradation
lcp00072  Synthesis and degradation of ketone bodies
lcp00280  Valine, leucine and isoleucine degradation
lcp00310  Lysine degradation
lcp00362  Benzoate degradation
lcp00380  Tryptophan metabolism
lcp00620  Pyruvate metabolism
lcp00630  Glyoxylate and dicarboxylate metabolism
lcp00640  Propanoate metabolism
lcp00650  Butanoate metabolism
lcp00900  Terpenoid backbone biosynthesis
lcp01100  Metabolic pathways
lcp01110  Biosynthesis of secondary metabolites
lcp01120  Microbial metabolism in diverse environments
lcp01130  Biosynthesis of antibiotics
lcp01200  Carbon metabolism
lcp01212  Fatty acid metabolism
lcp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lcp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LC55x_3194
   00630 Glyoxylate and dicarboxylate metabolism
    LC55x_3194
   00640 Propanoate metabolism
    LC55x_3194
   00650 Butanoate metabolism
    LC55x_3194
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LC55x_3194
   00072 Synthesis and degradation of ketone bodies
    LC55x_3194
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LC55x_3194
   00310 Lysine degradation
    LC55x_3194
   00380 Tryptophan metabolism
    LC55x_3194
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LC55x_3194
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LC55x_3194
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LC55x_3194
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcp04147]
    LC55x_3194
Enzymes [BR:lcp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LC55x_3194
Exosome [BR:lcp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LC55x_3194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALN86457
UniProt: A0A0S2FS35
Position
3620237..3621412
Genome map
AA seq 391 aa AA seqDB search
MSDVVIVGAKRTAIGSFLGQFTGVPTPTLGSAAIAGALEQAGVAADQIDEVIMGCVLPAG
LGQAPARQAALGANLPVSAGCTTINKVCGSGMKAIMLGHDLIKAGSAKLVVAGGMESMTN
APHVLNNSRTGIRYGSAEMLDHMAWDGLTNPYDGKAMGVFGDAACAKYDFDRAAIDAYSE
ESVKRAQAAQNGGHFKDEIVPVTVKGRKGDVVVDADEEPAKIDVAKIPTLRPAFGKDGVL
TAAASSKISDGAAATVLMSAEEAAARGLKPLARIVAHAGHAQAPEWFTTAPVKAISNVLE
KAGWTVADVDLFEINEAFSVVAMAPMKDLGISHDKLNVHGGAVALGHPIGASGARLVVTL
INALRIRGGKRGVASLCIGGGEATAIAIELL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgtcgtcatcgtcggtgccaagcgcaccgccatcggttccttcctcggccaa
ttcaccggcgtcccgaccccgaccctgggcagcgccgcgatcgccggcgcgctcgagcag
gccggcgtggccgccgaccagatcgacgaagtcatcatgggctgcgtgctcccggccggc
ctcggccaggctcccgcgcgccaggccgcgctcggcgcgaacctgccggtttcggccggc
tgcaccaccatcaacaaggtctgcggttcgggcatgaaggcgatcatgctgggccacgat
ctgatcaaggccggctcggccaagctggtcgtcgccggcggcatggagtcgatgaccaat
gccccgcacgtgctcaacaactcgcgcaccggcatccgctacggcagcgccgaaatgctc
gaccacatggcctgggacggtctgaccaatccctacgacggcaaggccatgggcgtgttc
ggggacgccgcctgcgccaagtacgatttcgaccgcgccgcgatcgacgcctactccgaa
gagagcgtcaagcgcgcccaggccgcgcagaatggcggccatttcaaggacgaaatcgtt
ccggtgacggtcaagggccgcaagggcgacgtggtcgtcgacgccgacgaagagccggcc
aagatcgacgtggccaagatcccgaccctgcgtccggcgttcggcaaggacggcgtgctg
accgccgccgcgtcctccaagatctccgacggcgccgccgccacggtgctgatgtcggcc
gaggaagccgccgcgcgcgggctcaagccgctggcccggatcgtcgcccacgccggccac
gcgcaggccccggaatggttcaccaccgcgccggtgaaagcgatttcaaacgtgctcgaa
aaggccggctggacggtcgccgacgtcgatctgttcgagatcaacgaagcgttctcggtg
gtcgccatggcgccgatgaaggacctgggcatcagccacgacaagctcaacgtccacggc
ggcgcggtcgcgctgggtcacccgatcggcgccagcggcgcccgcctggtggttaccctg
atcaacgccctgcgcatccgcggcggcaagcgcggcgtcgcctcgctgtgcatcggtggc
ggcgaagcgaccgcgatcgcgatcgaactgctgtaa

DBGET integrated database retrieval system