KEGG   Lysobacter capsici: LC55x_4226Help
Entry
LC55x_4226        CDS       T04162                                 

Gene name
cobQ
Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
lcp  Lysobacter capsici
Pathway
lcp00860  Porphyrin and chlorophyll metabolism
lcp01100  Metabolic pathways
Module
lcp_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:lcp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LC55x_4226 (cobQ)
Enzymes [BR:lcp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     LC55x_4226 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 MobB PriCT_1 BPL_N
Motif
Other DBs
NCBI-ProteinID: ALN87476
UniProt: A0A0S2FVA7
Position
complement(4686198..4687667)
Genome map
AA seq 489 aa AA seqDB search
MVQGCTSDAGKSALVTALCRWLHRRGVAVAPFKPQNMALNSAVTDDGGEIGRAQAVQAQA
AGLAPHTDFNPVLLKPNSDTGAQVILHGRAVANMDARGYHDYKRVAMDAVLQSHRRLVDG
FDAVVVEGAGSPAEINLRANDIANMGYAEAVDCPVLLIADIDRGGVFAHLVGTLALLSDS
ERARVAGFVINRFRGDIALLQPGLDWLERETGKPVIGVLPYLHGLHLEAEDALPRERAGD
ANATAGERLRVAVPALPRISNHNDFDALRAHPQVDCWFVGPGETPPPCDLIVLPGSKSTR
ADLQWLRRNGWATAIARHLRYGGKVIGICGGLQMLGQRISDPLGIEGEPGSDEGLGWLEL
DTVLEPEKQLRNVRGRLSIDDAAVSGYEIHCGVSTGAALQRPCLRFEDGRVDGAISADGR
ILGSYVHGLFDEPEALAALLRWAGLAQAQPLDLRGLREAAIDRLADAVQAHLDIARLEIL
FGLEAVCTA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggtccaaggctgcacctccgacgccggcaagagcgcgctggtgaccgcgctgtgtcgg
tggctgcatcggcgcggggtcgcggtggcgccgttcaagccgcagaacatggcgctcaat
tcggcggtgaccgacgacggcggcgagatcggccgcgcccaggcggtgcaggcgcaggcg
gccgggctggcgccgcacaccgacttcaatccggtgctgctcaaacccaacagcgacacc
ggcgcgcaggtgatcctgcacggccgtgcagtcgccaacatggatgcgcgtggttaccac
gactacaaacgcgtggcgatggatgcggtgctgcaatcgcaccggcgtttggtcgacggc
ttcgatgcggtcgtggtcgaaggcgccggcagtccggccgagatcaacctgcgcgccaac
gacatcgccaacatgggctatgccgaagcggtcgactgcccggtgttgctgatcgccgac
atcgaccgcggcggcgtgttcgcgcatctggtcggtactttggccttgctgtcggacagc
gagcgcgcgcgcgtcgccgggttcgtcatcaatcgctttcgcggcgatatcgccttgttg
cagccgggcctggactggctggagcgcgagaccggcaagccggtgatcggcgtattgccg
tatttgcacggcctgcatctggaagccgaggacgcgttgccgcgcgagcgagcgggcgac
gcgaacgccacggcgggcgaacgactgcgagtggcggttccggccttgccgcggatcagc
aaccacaacgatttcgatgcgctgcgcgcgcatccgcaggtcgactgctggttcgtcggt
ccgggcgaaaccccgccgccgtgcgatctgatcgtgctgccgggttccaagtcgacccgc
gccgatctgcagtggctgcggcgcaacggctgggcgaccgcgatcgcgcgccatctgcgc
tacggcggcaaggtgatcgggatctgcggcggtctgcagatgctcggccagcgcatcagc
gatccgctcggcatcgaaggcgagcccggcagcgatgaaggcctgggctggctcgaactg
gacacggtgctggagccggaaaagcaactgcgcaatgtgcgcggtcgcttgagcatcgac
gatgccgcggtcagcggttacgaaatccactgcggcgtcagcaccggcgccgcgttgcag
cggccgtgcctgcgtttcgaagacggccgcgtcgacggcgcgatttccgccgacggccgc
atcctcggcagctatgtgcacggtctgttcgacgaacccgaggccctggcggcgctgttg
cgctgggccggattggcgcaggcgcagccgctggatctgcgcggcctgcgcgaagccgcg
atcgaccgcctcgccgatgcggtgcaggcgcatctggatatcgctcggctcgaaatcctg
ttcggattggaggccgtatgcacagcctga

DBGET integrated database retrieval system