KEGG   Lucilia cuprina (Australian sheep blowfly): 111675786Help
Entry
111675786         CDS       T06013                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 2
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
lcq  Lucilia cuprina (Australian sheep blowfly)
Pathway
lcq00260  Glycine, serine and threonine metabolism
lcq01100  Metabolic pathways
lcq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lcq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    111675786
Enzymes [BR:lcq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     111675786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 111675786
NCBI-ProteinID: XP_023292395
Position
Unknown
AA seq 390 aa AA seqDB search
MSPSPSSTSSYYTVDIRSDTVSLPTIEMRQAMFEAKVGDDVYGEDPTVLELEKKCASLFE
KEAALLVPSGTMANLLAIMVHCHRRGTEAIVGDLSHTFLYEQAGAAQIAGVQLATIKNKT
DGTFCLREMQHKMRLYDDNHEPVTALVIVENTHNMCGGKVLPLEWLNELAGICKNPAKTN
GKNIALHMDGARVFNAAAYLNVPVARITKDFDSVCFCLSKGLSAPVGSVLVGTKAFIREA
RHLRKVLGGGMRQCGILAAAGLVALETIVPRLNGDHERTKRIAEALHNLRSPNFSVDLVN
VHSNILLIHMVNPKITASDFAKRLGEVTSQELQDGLTTTTDDGSLGIVLKVSARDWAYAR
IVLYHQITDKDVDYVIKKFEYVVKEFDGLL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccgtcaccatcatcaacgtcttcttattataccgttgacatacgttccgatacg
gtaagtttacccactattgaaatgcgtcaagctatgttcgaggcaaaagttggcgatgat
gtttatggcgaagatccaacagttttggaattggaaaaaaagtgtgcctcgttatttgaa
aaggaagctgctctgttagtacctagtgggacaatggcaaatttattagcaataatggtt
cactgtcatagacgcggtaccgaggctattgttggtgacctatcccatacattcctctat
gaacaggctggtgcagcacaaattgccggtgtacaattagcaacaattaaaaataaaaca
gacggcacattttgtctccgtgaaatgcaacataaaatgagactttacgatgacaaccat
gaacccgttacggcgctggttattgtcgaaaatacacacaacatgtgcggtggcaaagtg
ttacccctcgaatggttgaatgaactggctggcatttgtaaaaatcccgcaaagacaaat
ggcaaaaatattgccctccacatggatggtgctcgggtatttaatgctgcggcatattta
aatgtgcctgtggcacgtataacaaaggatttcgattcggtgtgcttttgcttgagtaaa
ggtctatcggcaccagtcggttcagtattggtgggaacaaaagcttttattagagaagct
cgtcatttacgtaaagttttaggtggtggtatgcgtcaatgtggcattttagctgctgcc
ggcttagtggcacttgagacaatagtacctcgcttaaatggggatcatgaaagaacaaaa
cgtatcgcagaagctttacataatctacgcagtcccaactttagtgttgacctagtaaat
gttcactctaatatactgttgattcatatggttaatccaaaaataactgccagtgacttt
gctaaacgtttgggtgaagtaacatctcaagaacttcaagatggtttaacgacaacaaca
gacgatggcagtctgggtattgtattgaaggtcagtgcccgtgactgggcatatgcacgc
attgtattgtatcatcagataacggataaggatgttgactatgtgattaaaaagtttgag
tatgtcgttaaagaatttgatggtttgttataa

DBGET integrated database retrieval system