KEGG   Lucilia cuprina (Australian sheep blowfly): 111675931Help
Entry
111675931         CDS       T06013                                 

Definition
(RefSeq) farnesyl pyrophosphate synthase
  KO
K00787  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
lcq  Lucilia cuprina (Australian sheep blowfly)
Pathway
lcq00900  Terpenoid backbone biosynthesis
lcq01100  Metabolic pathways
Module
lcq_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:lcq00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    111675931
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:lcq01006]
    111675931
Enzymes [BR:lcq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     111675931
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     111675931
Prenyltransferases [BR:lcq01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   111675931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt LPD22
Motif
Other DBs
NCBI-GeneID: 111675931
NCBI-ProteinID: XP_023292579
Position
Unknown
AA seq 423 aa AA seqDB search
MLNVIKNGFVANRSLNLLGPMLTKRFISTTGYVYNSEKISKDVGDRIGGVPTNLVNQEKI
RKTSRTLSTLQNQSVPIAARVTVSKDESRNFMAVFPDIVRDLTEAANSYNSSDASNWFAR
ALEYNVPKGKMNRGILTVLTYKNLVNAKDITDENLKLAHILGWCVEMLQCFFIINDDVMD
SSSTRRGQPCWYKVEDVGLIALNDALMIENAIYILLKKYFSHMDCYVDLMDLFHEITFIT
TCGQSLDLLNANKSVTSFNMDKYNAIVANKTAYYSFYLPFALAMHLAGIKDQEAFRQSKT
ILLEMGHFFQVQDDFLDCFGNPEITGKIGTDIQDNKCSWLAVVCMQRANEEQKKIMLECY
GKTDPEKAARVKQLYKSLGLPNTYAIYEEESYNMIKTHIQQTSRGVPHEIFLQILNKIYQ
RNS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatgtaataaaaaatggtttcgttgcgaataggtccttaaatttgttagggcca
atgctgacaaaacgttttatatcaaccacaggatatgtctataattctgaaaaaatctca
aaagatgttggagatcgcattggcggagtaccaacaaatttagtaaatcaagaaaaaata
agaaagacctcaagaactttgtcaacacttcagaatcaatctgtgccaatagcagctaga
gtaacggtctcaaaggacgaaagccgaaattttatggcggtttttcctgatattgtacgt
gacctaactgaagcagccaacagttacaattcaagtgatgcatccaattggtttgcccgc
gctttggagtacaatgtacccaaaggtaagatgaatcgaggcattcttaccgtcttaaca
tacaaaaatctagtcaacgccaaggacattacagacgaaaatttaaaattggcacatatt
ttgggatggtgtgttgaaatgctacaatgtttctttattatcaatgatgatgtgatggat
agtagttcaactagacgaggacagccatgttggtataaagtagaagatgtcggcttgata
gctttaaatgatgctttaatgattgaaaatgctatttatatcctactgaaaaaatacttc
agccatatggattgttatgtggacttaatggatctttttcatgaaatcacattcattaca
acttgcggccaaagtttagacttactaaacgccaacaaaagtgtaacatcatttaatatg
gacaaatataatgcaattgttgcaaataaaactgcatattattcattctatttgccattt
gccctagcaatgcacttagccggtattaaggaccaagaagcttttcgacaatcaaaaacc
attctcttggaaatgggtcacttttttcaggttcaagatgactttttagattgttttgga
aatcccgagattactggaaaaattggcaccgatatccaagacaataaatgttcttggtta
gctgtagtttgtatgcaaagagctaatgaagaacagaagaaaatcatgttagaatgctat
ggaaaaaccgatccagaaaaggcagcacgagtaaaacagttatataaatcgttgggactt
cccaatacgtatgctatatatgaggaagaatcctacaacatgataaagactcatatacag
caaacatcgcgaggtgtaccccatgagattttcttgcaaattttaaacaaaatttaccag
cgaaattcctaa

DBGET integrated database retrieval system