KEGG   Lucilia cuprina (Australian sheep blowfly): 111679252Help
Entry
111679252         CDS       T06013                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2 isoform X1
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
lcq  Lucilia cuprina (Australian sheep blowfly)
Brite
KEGG Orthology (KO) [BR:lcq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcq01001]
    111679252
Enzymes [BR:lcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111679252
Protein kinases [BR:lcq01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   111679252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like
Motif
Other DBs
NCBI-GeneID: 111679252
NCBI-ProteinID: XP_023296551
Position
Unknown
AA seq 373 aa AA seqDB search
MFKIAKPPMSQSAGQHQQHVQQRTPKTTPLVDDYEISNTVLGLGINGKVVECTNRKTNQK
YALKVLLDSPKARREVDLHWRVSSCRHIVNIADVYENTYAGNKCLLVVMECMEGGELFQR
IQDNADGAFTEREAAQIMHEICVAVHFLHSRDIAHRDLKPENLLYTSPHPNAILKLTDFG
FAKETLIKDTLQTPCYTPYYVAPEVLGPEKYDKSCDIWSLGVIMYILLCGFPPFYSNNGL
AISPGMKKRIRTGQYDFPNPEWKNVSQSAKDLIKGMLNVDPSKRLTIEEVMRNKWIAQYM
EVPMTPLCTGRMLKEGEETWPEVQEEMTRSLATMRVDYDQVSQMHIKALDKSNNALLSKR
RKKIEEMTAAQKK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaatagccaaaccaccaatgagtcaaagtgctggacaacatcagcagcatgta
cagcaacgtacacctaaaaccacgcctctagtcgatgactatgaaatatcaaatacagta
ttgggtttgggtataaatggaaaagttgttgaatgtacaaatcgtaaaacaaatcaaaaa
tatgcattaaaggttttattggacagtcctaaagcgagacgtgaagttgacctacattgg
cgtgtcagtagctgtcgtcatattgtcaatattgccgatgtctatgagaatacatatgct
ggtaataaatgtctcttagtcgttatggaatgcatggagggtggtgaactttttcaacgt
atacaagataatgcagatggtgcatttaccgaaagagaggctgctcaaataatgcatgaa
atctgtgtggccgtacattttctgcatagtcgtgatattgctcatcgtgatttgaaacct
gaaaatttattatacacatcgccacatccaaatgctattttaaaattaacagattttggc
tttgccaaagagacccttatcaaggataccctacaaacgccatgctatacaccatattat
gttgctcccgaagttttgggccccgagaaatacgacaaaagttgcgatatttggtcttta
ggcgttattatgtacattttactttgtggctttccaccattctacagtaacaatggtctt
gccatatcgccgggcatgaagaaacgtatacgtaccggtcaatatgattttcccaatcca
gaatggaaaaatgtcagccaatcggccaaggacttaattaaaggcatgttaaatgtagat
cccagtaaacgtttgaccatcgaagaagtaatgcgtaataaatggattgcccagtatatg
gaagtaccaatgacaccactctgtacaggacgtatgttaaaagagggcgaagaaacatgg
cctgaagtgcaagaagaaatgaccagatccttggcaacaatgagagttgattatgatcag
gtgagtcagatgcacatcaaggctttggataaatcaaacaacgctttattaagtaaaaga
cgaaaaaagattgaggaaatgactgctgctcaaaaaaagtag

DBGET integrated database retrieval system