KEGG   Lucilia cuprina (Australian sheep blowfly): 111680534Help
Entry
111680534         CDS       T06013                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
lcq  Lucilia cuprina (Australian sheep blowfly)
Brite
KEGG Orthology (KO) [BR:lcq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lcq04131]
    111680534
Membrane trafficking [BR:lcq04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    111680534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 111680534
NCBI-ProteinID: XP_023297960
Position
Unknown
AA seq 2079 aa AA seqDB search
MSITQRSFAQKLSRTHASDVRKNVVNCHMQTKTTDSSMCSSTLSLTEPVEPLDYEEFLNS
HINTINRDPLKNILDFPPGDVTVKTIPRKIRTIEHIVPKENFAELPQHVQECVNCYTRPW
KVVEYAQRHYSSSCCARERIDRGTISPSAYQQEFEVDKDFASFDESSLTDQSNSCTPSSR
QSIASLSSVSSCTDTLTPRGSWASFDLRRSVNDPLIPNLLDDVPPEHIDQTNESKRLEDR
QEALFSLYPEADAEDIIERRLSAELPMEHMGHRIFVKCLQLRLELEVEPIFASMAIYDAK
EKKKISENFYFDMNSDTLKRMLHTHVRCADESTQSRAGIFEISYPSNDLFLVIRLEKVLQ
GDIKDSVEPYIKDDKDKCREKAKQNASDFCERLGKYRMPFAWTGIYLTNIFNGDSFEGGK
EGIGLGGNQDRETGGSLGSAASSNSLDRKSSTSSFDQLRRKANDMSGTLTRRGSLERKEK
RRSWSPDDFANVVESFRPITITISSFFKQETDKMKDEDLYKFLMELKRPSSAMKKYKCIP
GSIKLEISPCTDDVKNALTPELAKVEPYVEDNTRPVKEILEIPPTAIYNPHYTYRNLLFV
SPKELNFSSRAGSARNIAVRVQLMAGETQNDAINAIFGKSSCPEYSNEAFTAVNYHNKCP
AFYDEIKFALPAHLKQNHHLFFTIYHVSCQKKPQDLQPSVETPVGYTWWPLLEDGKLKVG
EFQLPVMVETPPENYSFIPPNVHLPGTKWLDNHRPVFSISVEAVTSVHTLDPNLDRFFLM
CDYLNSRKIPPRIGEGNMEAEMKKCLLEIANAEREPLVKNLHLVLDKLIELLVTTYKIGG
QTLSLGSTVFEVLCLVSSNLSILSDDLIVDQYGRQSLLSTYVQFQSKIPHPFSGKRRITC
SRSNAEEMHTSSSSSDTYSIYDNVVAGRSLDRKEMAMEMSPTFVGRDGQIRLLHEELALH
WVVASGRAADLAMSNSWFLFELIVKSMIEHLDFTRSLQAPRKQRFPHQYTDDISTLVHLV
TTKVVGYHSNEPKLAQCLNASLSFFIFDLFSVMDRGFIFGLIKTYYKVLISKNASIPDLM
NYKIDFLRIVCSHEHYVALNLPFGTPYTTKSAPCSPTPSTNSNTSGTSYGSIERALHADL
SIEFRQQHFLVGLVLSDLATVLEVPNPQLHGKAIRCIRNLMTSHDLDPRYSDSEARARVA
SLYLPLLGIVMDAIPQLHQYLTDSNDRLHNMGLLDDYQGPHTTIATTTISPEVAYAISGS
RSYAYMNDHVKNKSPLSSENTRHLLACCTWILKNLERTALYRWTLGLSPHRVHQMLQVLN
TCIPCFEYKGQKRLPVLKRNTQSFRKPTDLKEKLEECIRGTNSARYDLINRRKDRNSTEK
FRWRKDQMPYRAQFYDTITKTDPELELSHYIEGSLATEITLVILDCLEIIVQVATNSEMH
HNLLGTVLKVLLHALSRNQSTLALKNLFSSQRSLIFKFPNLLFDEETDICADLCLLLLKH
CGSQLPGIRSQAAASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSSSFSEQSLRRAL
KTILVYAESDSDLQDTSFPEQVQDLLFNLHMILSDTVKMKEYQEDPEMLLDLMHRIAKGY
QNNPDLRLTWLENMAKKHKERANHTEAAMCFVHSAALVAEYLSMLESQPHLPVGAVSFQK
VTPNSLLESAVSDDVLSPGEDGICLGNHFTESGLKALLEEASNSFQIAGMYEAMNEVYKI
LIPICEANRDFQKLSKIHGKLQEAFNRIAQLQGKRVFGTYFRVGFYGAKFGDLDQQEFIY
KEPTLTKLPEIFSRLQNFYADRFGPDSVHIIKDSNSVDVNSLDPDKAYIQITYVEPYFEN
YELRHRETYFERNFNIKRFIFATPFTKSGKAHGDLHEQCKRKTILTTANHFPYVKTRIQV
INRQQIILDPIEVAIEDIQKKTLELAAATNQEPADPKILQMVLQGCIGTTVNQGPMEMAA
VFLSNLSDGVTIPTKNQNKLRLCFREFSKRCADALKKNRNLILSDQKDYQRELERNNERF
VERLTPLITLTPTQAQGVVKANAASNRSTPLKCVSDYFK
NT seq 6240 nt NT seq  +upstreamnt  +downstreamnt
atgtccattacacagcgctcttttgcgcaaaagttgtctaggactcatgctagtgatgtg
cgtaaaaatgtggtcaattgtcatatgcaaacgaaaacaacagattcttctatgtgctcc
tcgactctttccttaaccgaacccgttgagccattggattacgaagagtttttaaattct
catataaacactattaatcgtgatcctttaaaaaatatactcgattttccaccaggagat
gttacggtcaaaactataccacgtaaaattagaaccatagaacacattgtgccaaaggaa
aattttgctgaactgcctcaacatgttcaggagtgtgttaactgttatacacgtccctgg
aaagtggtggaatatgctcaacgtcattattctagttcttgttgtgctcgtgaacgtatt
gatcgaggcacaataagcccttcggcctatcagcaagagtttgaagtagataaagatttt
gcctctttcgatgagtcctctttaaccgatcaaagtaacagttgcactcccagctctagg
caatctattgccagtttatcttccgtgagctcttgtactgatactttaacacctcgtggt
tcttgggctagttttgacctaagacgttctgtaaacgatcccttaataccgaatttatta
gatgatgttcctcccgaacatattgatcaaacaaacgaatcaaagagattggaagatcga
caagaagctctcttctctctttatcccgaagcagatgccgaagatataatagaacgtcga
ttatcggctgaattacccatggaacatatgggtcaccgcatatttgtaaaatgtttacaa
ttaagactggaattggaggtagaaccaatatttgcctctatggccatatatgatgccaaa
gaaaagaaaaagatttcggaaaatttttattttgacatgaactcggacaccttaaaacgt
atgctacatacgcacgtgcgctgtgccgatgaaagtacccaaagtagagcgggtattttt
gaaataagttatcccagcaatgatttgtttttggtaatacgtttggaaaaagttttgcag
ggtgatattaaggattcagtggagccttatatcaaagatgataaagataaatgtcgtgaa
aaagccaaacaaaatgcctcagacttttgtgaaaggttagggaaataccgcatgcctttc
gcttggactggtatatatttaaccaatattttcaatggagatagttttgagggcggaaaa
gagggtattggtttgggcggtaatcaagatcgcgaaactgggggttctttgggatctgca
gccagttctaacagcttagatcgcaaatcatctaccagtagttttgatcaactaagacgt
aaagctaatgatatgagtggtactttaacacgacgaggatctttggaacgtaaagaaaag
agacgctcttggtcacctgatgattttgccaatgtggtcgaatcatttcgaccgattact
ataactatttccagtttctttaagcaagaaaccgataaaatgaaagatgaagatctctat
aaatttttaatggaactaaaaagacccagttcggccatgaagaaatacaaatgcataccc
ggctctataaaattggaaatttcaccctgcacagatgatgttaagaatgccttaactcct
gaattggctaaagtagagccatatgtggaggataacactagaccagtgaaagaaatacta
gaaatacctcctaccgctatttataatccccactacacttatcgtaatctattgtttgtg
tcacccaaagaacttaacttttcttcaagggccggttctgctcgaaatattgctgttaga
gtacaacttatggcgggagaaacacagaacgatgccattaatgccatatttggaaaatca
tcatgccccgagtattctaatgaagcttttacagccgtcaattatcacaacaaatgtcca
gcattctatgatgaaattaaatttgctctaccagctcatctcaaacaaaatcatcatctt
ttctttaccatttatcatgtttcatgtcaaaagaaaccacaagacttgcaaccatccgtt
gaaacaccggtgggttatacctggtggcctttattagaggatggcaaacttaaagtggga
gaatttcaattgccagttatggtcgaaactcctccagaaaattattcttttataccacca
aatgttcatttacccggcactaaatggctggataaccatcgtcctgtcttttccataagc
gtggaggcagttacttcagtacatactttggatcctaatttagatcgtttctttttgatg
tgtgattatttaaattctcgcaagattccaccacgtataggtgaaggcaatatggaagct
gagatgaaaaaatgtttattggaaattgcaaatgctgaacgtgaacctttggtgaagaat
ttacatttagttttggataaacttatagaactcttggtaacaacatataaaattggcgga
caaacgctttcactgggttccacagttttcgaagttttgtgtttggtatcatctaactta
tcgattttaagcgatgacttaatagtagatcaatatggccgccagtctttactatccact
tatgtgcaatttcaaagcaaaataccacatcctttcagtggtaagagacgcataacctgc
agccgcagtaatgctgaagaaatgcacacttcttcctcttcatcagatacatatagcatt
tacgataatgtagtagccggacgtagtttggatcgcaaagaaatggccatggaaatgtca
ccaacatttgttggacgcgacggacaaatacgtttattgcatgaagaattagctttgcat
tgggtagtagccagcggacgtgctgctgatttagccatgagtaattcatggtttttattc
gaattgattgttaaatccatgatagaacatttggattttacgcgatctctacaagcacca
agaaaacaaagatttcctcatcaatacacagatgatatatcgactttggtacacttagtg
accaccaaagtggtgggttatcacagcaacgaaccaaaattggcacaatgtcttaatgcc
agtttaagtttctttatatttgacttatttagtgtcatggatagaggttttatatttggt
ttaataaaaacctattacaaggttttgatatcgaaaaatgcctctataccggatttgatg
aattataaaatagattttttgcgtatagtttgtagtcatgaacattatgtggctttaaat
ttaccctttggcactccgtatacaacgaaatctgcaccctgcagtccaacaccaagtacc
aactcaaacactagtggaacatcatatggttccattgaacgagccttacatgccgattta
agcatcgaatttaggcaacaacattttctggttggtttggttctaagtgatttggctacc
gttttggaagtaccaaatcctcaactgcatggcaaagctataagatgtatacgcaattta
atgacttctcatgacttggatccacgctatagtgatagtgaagcaagagcacgtgtagct
tctctatatctgcctttgctgggcatagtaatggatgccataccacaattacatcaatat
ctaaccgactccaatgatcgtttacacaatatgggtttattagatgactaccagggtcca
cacactaccattgccaccacaactataagtcccgaagtagcttatgccatatcgggttcc
agatcttatgcctacatgaatgatcatgtaaagaataaatcacctttgagtagtgaaaat
acacgtcatctattagcttgttgcacttggatattgaaaaatctcgaaagaactgcttta
tatagatggactttaggactatcaccacatagagtgcatcagatgttgcaggtgttgaat
acttgtataccttgtttcgaatataagggacagaaacgtttgcctgtcttaaaacgtaat
acacaaagtttccgcaaacctacagatcttaaagaaaaactagaggagtgtatacgtggc
accaactcggcgcgttatgatttaataaatcgacgcaaagatcgtaattcaacggagaaa
ttccgttggcgtaaagatcaaatgccctatagggcacaattttatgatactataacaaaa
actgatccagaattagaattgagtcattatatagaaggatcattggcaaccgaaattact
ctggttattttagattgtttggaaattattgtacaagtggctacaaattccgaaatgcat
cataatcttttgggtacagtgttgaaagtattgttgcatgccttgtcgcgtaatcaaagt
actttagcattgaagaatttgttttcatcacaaagatcattgatctttaaatttccaaat
ttgttgttcgatgaggaaaccgacatctgtgctgacttgtgtttactgttgctaaagcac
tgtggttcacagttgcctggtataagatcgcaggctgctgcttccttatatttgctaatg
aggcaaaattttgaaatcggcaataattttgctcgtgttaaaatgcaagtaactatgtct
ctatcatctttagtgggcactagctcatctttcagcgaacagtctttaagacgagccctt
aaaaccattttagtttatgctgaatccgattcagatcttcaagatacctcgttcccagaa
caagtacaagatctgttattcaatctgcatatgatactctcggacacggtaaaaatgaaa
gaatatcaagaagatccggaaatgttgttggatcttatgcatcgtattgccaaaggttat
caaaataatcccgatttacgtttaacatggttagagaatatggccaagaaacacaaagag
cgtgccaatcacactgaggcagctatgtgttttgttcattccgctgctctggtagccgaa
tatctaagtatgttggagtcgcaacctcatctaccagtaggtgcagtaagtttccagaaa
gtcacacccaactctttgctagagtctgctgtttccgatgacgttctaagtcctggcgaa
gatggtatctgcttgggtaatcatttcactgaatcaggcctgaaagctttgctggaagaa
gcctctaattccttccaaatagcgggcatgtatgaggccatgaatgaagtttataagata
cttatacccatctgcgaggccaacagagatttccagaagttaagtaaaattcatggtaaa
ttacaggaggccttcaatcgtatcgcacaactgcagggcaaacgagtctttggaacttat
ttcagagttggtttctatggtgccaaatttggtgatttagatcagcaagagtttatttac
aaggaaccgactcttaccaagttacccgaaatatttagtcggcttcagaacttttatgct
gatcgttttggccctgactctgttcacattattaaagattccaatagtgtagatgtaaat
agtttagatcccgataaggcttatatacagatcacctatgtagagccctattttgaaaac
tatgagctacgtcatcgagaaacctactttgaaagaaacttcaacataaaacgttttatt
tttgccaccccattcaccaagtcgggcaaagcacatggtgatttgcatgaacaatgtaaa
cgcaagactatacttactacagccaatcatttcccatacgtcaagacacgtattcaagtt
ataaatcgtcaacaaatcattttggatcccattgaagtggccatcgaagatatacaaaag
aaaacattggaattggcagcggctaccaatcaagaaccagctgatcccaagatactacaa
atggtcttacaaggctgtattggtaccactgtcaatcagggtcctatggaaatggcagcc
gtatttctatcgaatctctcggatggtgtaactataccaacgaaaaatcaaaataaatta
cgtttatgctttagagaattttccaaacgttgtgctgatgctcttaagaaaaatcgcaat
ttaattttatccgatcaaaaagattatcaacgtgaattggaacgtaataatgaacgtttt
gtagaacgtttgacaccattaataacattaacacccacgcaggcgcagggtgtagtaaaa
gcaaatgccgctagcaatcgtagtacacccttaaaatgtgtttccgattatttcaagtaa

DBGET integrated database retrieval system