KEGG   Lucilia cuprina (Australian sheep blowfly): 111681612Help
Entry
111681612         CDS       T06013                                 

Definition
(RefSeq) heat shock protein 70-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
lcq  Lucilia cuprina (Australian sheep blowfly)
Pathway
lcq03040  Spliceosome
lcq04141  Protein processing in endoplasmic reticulum
lcq04144  Endocytosis
lcq04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:lcq00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111681612
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111681612
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111681612
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    111681612
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lcq01009]
    111681612
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lcq03041]
    111681612
   03009 Ribosome biogenesis [BR:lcq03009]
    111681612
   03110 Chaperones and folding catalysts [BR:lcq03110]
    111681612
   04131 Membrane trafficking [BR:lcq04131]
    111681612
   03051 Proteasome [BR:lcq03051]
    111681612
   03029 Mitochondrial biogenesis [BR:lcq03029]
    111681612
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcq04147]
    111681612
Protein phosphatases and associated proteins [BR:lcq01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     111681612
Spliceosome [BR:lcq03041]
 Complex B
  Other components
   Prp19 complex
    111681612
 Complex C
   Prp19-CDC5 complex
    111681612
Ribosome biogenesis [BR:lcq03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    111681612
Chaperones and folding catalysts [BR:lcq03110]
 Heat shock proteins
  HSP70 / DNAK
   111681612
Membrane trafficking [BR:lcq04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    111681612
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    111681612
Proteasome [BR:lcq03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    111681612
Mitochondrial biogenesis [BR:lcq03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    111681612
Exosome [BR:lcq04147]
 Exosomal proteins
  Proteins found in most exosomes
   111681612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl StbA Hydantoinase_A FGGY_C DIOX_N
Motif
Other DBs
NCBI-GeneID: 111681612
NCBI-ProteinID: XP_023299248
Position
Unknown
AA seq 544 aa AA seqDB search
MAFLEDSTVFPQKYLENTKVKTTTNHSSSLYTQQRRKAYLGQTVTDAVITVPAYFNDSQR
QATKDAGRIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEG
SLFEVRATAGDTHLGGEDFDNRLVSHLADEFKRKCKKDIRSNPRSLRRLRTAAERAKRTL
SSSTEASIEIDALFEGQDFYTKVSRARFEELCADLFRQTLEPVEKALNDAKMDKNQIHDI
VLVGGSTRIPKVQSLLQQFFCGKSLNLSINPDEAVAYGAAIQAAILSGDKSSAIQDVLLV
DVAPLSLGIETAGGVMAKIIERNTRIPCKQTQTFSTYSDNQPGVSIQVFEGERVMTKDNN
KLGTFDLSGIPPAPRGVPQIEVTFDLDANGILNVSAKEMSSGNVKNITIKNDKGRLSQAE
IDRMVSEAEKFAEEDEKQKNKISARNNLEGYVFGVKQALDQAGDKISAQEKGEALRACED
TIKWLDANTLAEKEEYEDKMNSLTKLCTPIMTKLHNGGGAGPSCGQQAGGFGAGRSGPTV
EEVD
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttctagaagattcaacagtattcccgcaaaagtatctagaaaataccaaagta
aaaactactacaaatcattcatcaagtttatatacacaacaaagaagaaaagcctatttg
ggtcagacagtaaccgatgcagtaattacagttcctgcctactttaacgattcacagaga
caagccaccaaagatgctggtcgtattgctggtttaaatgtattgagaattatcaatgaa
cccacggcggctgctctagcatatggtctcgataagaacttgaaaggcgaacgtaacgta
ctcatctttgatttgggcggtggtacttttgatgtctccatcttaaccatcgacgaaggt
tcattatttgaagtgagagcaactgctggcgatactcacttgggtggtgaagatttcgac
aacagactcgtctcacacctggccgatgaattcaaacgcaaatgcaagaaagatattcgc
tctaatcccagatcattgagacgtttaagaactgctgctgaacgtgccaaacgtacattg
tcatccagcactgaagcctccattgaaattgatgctctatttgagggtcaagatttctac
actaaagtgagtcgtgccagatttgaagaattgtgtgctgatctattccgtcaaacattg
gaaccggttgagaaagccctcaatgatgctaaaatggacaagaaccaaatacatgatatt
gtactggttggtggctctacacgcatccctaaagttcaaagtcttcttcaacaattcttc
tgtggcaagagtctaaacttgtccattaatcccgatgaagctgtggcctacggtgctgct
attcaggcggctatacttagtggtgataagagcagtgctattcaagatgttctgctggta
gatgtggctccactatcacttggcatcgaaactgctggcggtgtaatggcaaagatcatc
gagcgcaacacacgcattccatgcaaacaaacacaaaccttctccacctattcggataat
caacctggtgtaagcatccaagtctttgaaggtgaacgtgtcatgacaaaggacaacaac
aaattgggcacatttgatctctctggcattccaccagctcctcgtggtgtgccacaaatt
gaagtcactttcgaccttgatgccaatggcattctaaatgtttctgcaaaggaaatgagt
tctggcaatgtcaagaacatcactattaagaacgataaaggacgtttgtcacaagccgaa
atcgatcgcatggtcagtgaggctgagaaattcgccgaagaagatgagaagcagaaaaat
aagattagtgctcgcaacaatttggaaggttatgtgtttggtgtaaaacaagcattggat
caagctggtgataagatttctgcacaggaaaagggtgaagccttgcgtgcatgtgaagat
acaatcaagtggttagatgccaatacattggctgaaaaggaggaatacgaagacaagatg
aattcactcacaaaattatgcacaccaataatgaccaaattacacaatggaggaggtgct
ggaccatcatgtggtcaacaggctggtggatttggtgccggcagaagtggtcccactgta
gaagaagtagattaa

DBGET integrated database retrieval system